ARSA (Search Result) Help

Search Condition

Advanced Search Quick Search

Field

Primary Accession Number

e.g.	Same as Quick Search
`AA000001`	`PrimaryAccessionNumber:AA000001` `pa:AA000001`
`AA00000*`	`pa:AA00000*`
`/AA00000[1-3]/`	`pa:/AA00000[1-3]/`
`AA000001 AA000002`	`pa:(AA000001 OR AA000002)`

Hide examples

Accession Number

e.g.	Same as Quick Search
`AA000001`	`AccessionNumber:AA000001` `an:AA000001`
`AA00000*`	`an:AA00000*`
`/AA00000[1-3]/`	`an:/AA00000[1-3]/`
`AA000001 AA000002`	`an:(AA000001 OR AA000002)`

Hide examples

Sequence Length

e.g.			Same as Quick Search
`400`	to	`500`	`SequenceLength:[400 TO 500]` `sl:[400 TO 500]`
	to	`500`	`sl:[* TO 500]`
`100`	to		`sl:[100 TO *]`
`450`	to	`450`	`sl:450`

Hide examples

Molecular Type

DNA RNA cRNA mRNA rRNA tRNA PRT

Same as Quick Search
`MolecularType:DNA` `mt:DNA`
`mt:(DNA OR RNA)`

Hide examples

Molecular Form

circular linear

Same as Quick Search
`MolecularForm:circular` `mf:circular`
`mf:(circular OR linear)`

Hide examples

Division

Same as Quick Search
`Division:BCT` `dv:BCT`
`dv:(BCT OR CON)`

Hide examples

Date

e.g.			Same as Quick Search
`20130101`	to	`20131231`	`Date:[20130101 TO 20131231]` `dt:[20130101 TO 20131231]`
	to	`20131231`	`dt:[* TO 20131231]`
`20130101`	to		`dt:[20130101 TO *]`
`20130401`	to	`20130401`	`dt:20130401`

Hide examples

Definition

e.g.	Same as Quick Search
`"catalase gene"`	`Definition:"catalase gene"` `df:"catalase gene"`
`"Homo sapiens cDNA, clone:ABC123, 3' end, expressed in brain"`	`df:"Homo sapiens cDNA, clone:ABC123, 3' end, expressed in brain"`
`/Homo sapiens cDNA, clone:[A-Z0-9]+, 3' end, expressed in brain/`	`df:/Homo sapiens cDNA, clone:[A-Z0-9]+, 3' end, expressed in brain/`

Hide examples

Keyword

e.g.	Same as Quick Search
`BARCODE`	`Keyword:BARCODE` `kw:BARCODE`
`HTGS_*`	`kw:HTGS_*`
`\(3'-EST\)`	`kw:\(3'-EST\)`
`"(3'-EST)"`	`kw:"(3'-EST)"`
`/[35]\'-EST/`	`kw:/[35]\'-EST/`
`/TPA\:(experimental\|reassembly)/`	`kw:/TPA\:(experimental\|reassembly)/`

Hide examples

Organism

e.g.	Same as Quick Search
`"Homo sapiens"`	`Organism:"Homo sapiens"` `og:"Homo sapiens"`
`"Mus musculus" "Rattus norvegicus"`	`og:("Mus musculus" OR "Rattus norvegicus")`

Hide examples

Lineage

e.g.	Same as Quick Search
`Vertebrata`	`Lineage:Vertebrata` `ln:Vertebrata`
`Vertebrata Insecta`	`ln:(Vertebrata OR Insecta)`

Hide examples

Reference Authors

e.g.	Same as Quick Search
`Mishima`	`ReferenceAuthor:Mishima` `ra:Mishima`
`Mishima Shizuoka`	`ra:(Mishima OR Shizuoka)`

Hide examples

Reference Title

e.g.	Same as Quick Search
`"human liver"`	`ReferenceTitle:"human liver"` `rt:"human liver"`
`"stomach cancer" "gastric cancer"`	`rt:("stomach cancer" OR "gastric cancer")`

Hide examples

Reference Journal

e.g.	Same as Quick Search
`"National Institute of Genetics"`	`ReferenceJournal:"National Institute of Genetics"` `rj:"National Institute of Genetics"`

Hide examples

Reference PubmedID

e.g.	Same as Quick Search
`1234567`	`ReferencePubmedID:1234567` `rp:1111111`
`[2222222 TO 3333333]`	`rp:[2222222 TO 3333333]`
`[* TO 3333333]`	`rp:[* TO 3333333]`
`[2222222 TO *]`	`rp:[2222222 TO *]`
`4444444`	`rp:4444444`
`5555555 6666666`	`rp:(5555555 OR 6666666)`

Hide examples

Comment

e.g.	Same as Quick Search
`"Human cDNA sequencing project"`	`Comment:"Human cDNA sequencing project"` `cm:"Human cDNA sequencing project"`

Hide examples

Features

Feature Key	Qualifier Name	Qualifier Value
more features

e.g.			Same as Quick Search
Feature Key	Qualifier Name	Qualifier Value	Same as Quick Search
		`taxon:9606`	`Feature:"taxon:9606"` `fe:"taxon:9606"`
`source`	`chromosome`	`12`	`FeatureQualifier:("source /chromosome=12" AND "source /clone_lib=lambda gt11 human liver cDNA (GeneTech. No.20)" AND "source /db_xref=taxon:9606" AND "CDS /codon_start=1" AND "CDS /translation=")`
`source`	`clone_lib`	`lambda gt11 human liver cDNA (GeneTech. No.20)`
`source`	`db_xref`	`taxon:9606`
`CDS`	`codon_start`	`1`
`CDS`	`translation`
`source`	`chromosome`	`12`	`fq:("source /chromosome=12" AND "source /clone_lib=lambda gt11 human liver cDNA (GeneTech. No.20)" AND "source /db_xref=taxon:9606" AND "CDS /codon_start=1" AND "CDS /translation=")`
`source`	`clone_lib`	`lambda gt11 human liver cDNA (GeneTech. No.20)`
`source`	`db_xref`	`taxon:9606`
`CDS`	`codon_start`	`1`
`CDS`	`translation`

Hide examples

All Text

e.g.	Same as Quick Search
`human`	`AllText:human` `at:human`

Hide examples

Combine Searches with

Search Condition

Quick Search Advanced Search

Available Fields

Field	Query Formats
Primary Accession Number	Search all wordsPrimaryAccessionNumber:(AB999999 AND AB999998 ...) Search any wordsPrimaryAccessionNumber:(AB999999 OR AB999999 ...) Regexp queryPrimaryAccessionNumber:/regexp/
Accession Number	Search all wordsAccessionNumber:(AB999999 AND AB888888 ...) Search any wordsAccessionNumber:(AB999999 OR AB888888 ...) Regexp queryAccessionNumber:/regexp/
Division	Search any divisionsDivision:(HUM OR PRI ...)
Sequence Length	Search rangingSequenceLength:[450 TO 500]
Molecular Type	Search any molecular typesMolecularType:(mRNA OR DNA ...)
Molecular Form	Search any molecular formsMolecularForm:(circular OR linear)
Date	Search rangingDate:[20090601 TO 20090701]
Definition	Search all wordsDefinition:(partial AND cds ...) Search any wordsDefinition:(partial OR cds ...) Regexp queryDefinition:/regexp/ Search exactly matchDefinition:"partial cds"
Comment	Search all wordsComment:(sequencing AND project ...) Search any wordsComment:(sequencing OR project ...) Regexp queryComment:/regexp/ Search exactly matchComment:"sequencing project"
Keyword	Search all wordsKeyword:(HTC AND HTC_FLI ...) Search any wordsKeyword:(HTC OR HTC_FLI ...) Regexp queryKeyword:/regexp/ Search exactly matchKeyword:"oligo capping"
Organism	Search all wordsOrganism:(Homo AND sapiens ...) Search any wordsOrganism:(Homo OR sapiens ...) Regexp queryOrganism:/regexp/ Search exactly matchOrganism:"Homo sapiens"
Lineage	Search all wordsLineage:(Eukaryota AND Metazoa ...) Search any wordsLineage:(Eukaryota OR Metazoa ...) Regexp queryLineage:/regexp/
Reference Author	Search all wordsReferenceAuthor:(Mishima AND Shizuoka ...) Search any wordsReferenceAuthor:(Mishima OR Shizuoka ...) Regexp queryReferenceAuthor:/regexp/ Search exactly matchReferenceAuthor:"Mishima,H."
Reference Title	Search all wordsReferenceTitle:(expressed AND liver ...) Search any wordsReferenceTitle:(expressed OR liver ...) Regexp queryReferenceTitle:/regexp/ Search exactly matchReferenceTitle:"expressed in human liver"
Reference Journal	Search all wordsReferenceJournal:(30-NOV-2008 AND Hanako ...) Search any wordsReferenceJournal:(30-NOV-2008 OR Hanako ...) Regexp queryReferenceJournal:/regexp/ Search exactly matchReferenceJournal:"Hanako Mishima"
Reference PubmedID	Search all wordsReferencePubmedID:(1111111 AND 1111112 ...) Search any wordsReferencePubmedID:(1111111 OR 1111112 ...) Regexp queryReferencePubmedID:/regexp/ Search rangingReferencePubmedID:[1111110 TO 1111119]
Feature	Search all wordsFeature:(GT200015 AND gt11 ...) Search any wordsFeature:(GT200015 OR gt11 ...) Search exactly matchFeature:"gene=\"GAPD\""
Feature Qualifier	Search one feature-qualifierFeatureQualifier:/source \/clone=GT200015/ Search all feature-qualifiersFeatureQualifier:(/source \/clone=GT200015/ AND /CDS \/gene=GAPD/ ...)
All Text	Search with field_name 'AllText'AllText:any_formats

LOCUS	AB000000 450 bp mRNA linear HUM 01-JUN-2009
DEFINITION	Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds.
ACCESSION	AB999999 AB888888 AB777777
VERSION	AB000000.1
KEYWORDS	HTC; HTC_FLI; oligo capping.
SOURCE	Homo sapiens (human)
ORGANISM	Homo sapiens
	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
	Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
	Catarrhini; Hominidae; Homo.
REFERENCE	1 (bases 1 to 450)
AUTHORS	Mishima,H. and Shizuoka,T.
TITLE	Direct Submission
JOURNAL	Submitted (30-NOV-2008) to the DDBJ/EMBL/GenBank databases. Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; Yata 1111, Mishima, Shizuoka 411-8540, Japan
PUBMED	1111111
REFERENCE	2
AUTHORS	Mishima,H., Shizuoka,T. and Fuji,I.
TITLE	Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver
JOURNAL	Unpublished (2009)
COMMENT	Human cDNA sequencing project.
FEATURES		Location/Qualifiers
source		1..450
source		/chromosome="12"
source		/clone="GT200015"
source		/clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)"
source		/db_xref="taxon:9606"
source		/map="12p13"
source		/mol_type="mRNA"
source		/organism="Homo sapiens"
source		/tissue_type="liver"
CDS		86..>450
CDS		/codon_start=1
CDS		/gene="GAPD"
CDS		/product="glyceraldehyde-3-phosphate dehydrogenase"
CDS		/protein_id="BAA12345.1"
CDS		/transl_table=1
CDS		/translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV"
BASE COUNT 102 a 119 c 131 g 98 t
ORIGIN
1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct
61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg
121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc
181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt
241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg
301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac
361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc
421 tcaacttaag ggtggtgcta agaaggtctg
//

Search Result

Facet

List of Entries

1 - entries / Number of founds: 247809 FlatFile XML Fasta

	Definition	MolecularType	Organism	PrimaryAccessionNumber	SequenceLength
	Mus musculus adult male stomach cDNA, RIKEN full-length enriched library, clone:2210009G05 product:ATPase, H+/K+ transporting, beta polypeptide, gastric specific, full insert sequence.	mRNA	Mus musculus	AK008686	713
	AUF_IpSto_10_o23 Stomach cDNA library Ictalurus punctatus cDNA 5' similar to Potassium-transporting ATPase beta chain (Proton pump beta chain) (Gastric H+/K+ ATPase beta subunit), mRNA sequence.	mRNA	Ictalurus punctatus	CK426380	911
	CBNI7810.g1 CBNI: Normalized channel catfish cDNA library from stomach, muscle, olfactory tissue and trunk kidney (mixed tissue 2, AUL) Ictalurus punctatus cDNA 3' similar to zebrafish RefSeq, NP_998569.1, lipase, gastric [Danio rerio], mRNA sequence.	mRNA	Ictalurus punctatus	FD021817	677
	CBNI8747.b1 CBNI: Normalized channel catfish cDNA library from stomach, muscle, olfactory tissue and trunk kidney (mixed tissue 2, AUL) Ictalurus punctatus cDNA 5' similar to zebrafish RefSeq, NP_998569.1, lipase, gastric [Danio rerio], mRNA sequence.	mRNA	Ictalurus punctatus	FD022787	659
	CBFH34340.b1 CBFH: Normalized blue catfish cDNA library of stomach, muscle, olfactory tissue, and trunk kidney (mixed tissue 4, AUJ) Ictalurus furcatus cDNA 5' similar to zebrafish RefSeq, NP_998569.1, lipase, gastric [Danio rerio], mRNA sequence.	mRNA	Ictalurus furcatus	FD095725	140
	CBFH18517.b1 CBFH: Normalized blue catfish cDNA library of stomach, muscle, olfactory tissue, and trunk kidney (mixed tissue 4, AUJ) Ictalurus furcatus cDNA 5' similar to zebrafish RefSeq, XP_001339936.1, PREDICTED: similar to gastric mucin [Danio rerio], mRNA sequence.	mRNA	Ictalurus furcatus	FD077018	639
	CBFH19622.b1 CBFH: Normalized blue catfish cDNA library of stomach, muscle, olfactory tissue, and trunk kidney (mixed tissue 4, AUJ) Ictalurus furcatus cDNA 5' similar to zebrafish RefSeq, NP_998569.1, lipase, gastric [Danio rerio], mRNA sequence.	mRNA	Ictalurus furcatus	FD078455	597
	CBZC8782.b1 CBZC: Normalized blue catfish cDNA library from stomach, muscle, olfactory tissue and trunk kidney (mixed tissue 4, AUJ_M) Ictalurus furcatus cDNA 5' similar to zebrafish RefSeq, NP_998569.1, lipase, gastric [Danio rerio], mRNA sequence.	mRNA	Ictalurus furcatus	FD168193	761
	CBZC20928.b1 CBZC: Normalized blue catfish cDNA library from stomach, muscle, olfactory tissue and trunk kidney (mixed tissue 4, AUJ_M) Ictalurus furcatus cDNA 5' similar to zebrafish RefSeq, NP_998569.1, lipase, gastric [Danio rerio], mRNA sequence.	mRNA	Ictalurus furcatus	FD150687	645
	CBZC23786.b1 CBZC: Normalized blue catfish cDNA library from stomach, muscle, olfactory tissue and trunk kidney (mixed tissue 4, AUJ_M) Ictalurus furcatus cDNA 5' similar to zebrafish RefSeq, XP_001339936.1, PREDICTED: similar to gastric mucin [Danio rerio], mRNA sequence.	mRNA	Ictalurus furcatus	FD155975	770
	CBNI8747.g1 CBNI: Normalized channel catfish cDNA library from stomach, muscle, olfactory tissue and trunk kidney (mixed tissue 2, AUL) Ictalurus punctatus cDNA 3' similar to zebrafish RefSeq, NP_998569.1, lipase, gastric [Danio rerio], mRNA sequence.	mRNA	Ictalurus punctatus	FD022788	721
	CBZC10618.b1 CBZC: Normalized blue catfish cDNA library from stomach, muscle, olfactory tissue and trunk kidney (mixed tissue 4, AUJ_M) Ictalurus furcatus cDNA 5' similar to zebrafish RefSeq, XP_001339936.1, PREDICTED: similar to gastric mucin [Danio rerio], mRNA sequence.	mRNA	Ictalurus furcatus	FD140637	762
	CBFH31328.b1 CBFH: Normalized blue catfish cDNA library of stomach, muscle, olfactory tissue, and trunk kidney (mixed tissue 4, AUJ) Ictalurus furcatus cDNA 5' similar to zebrafish RefSeq, XP_001339936.1, PREDICTED: similar to gastric mucin [Danio rerio], mRNA sequence.	mRNA	Ictalurus furcatus	FD092643	236
	CBZC23873.b1 CBZC: Normalized blue catfish cDNA library from stomach, muscle, olfactory tissue and trunk kidney (mixed tissue 4, AUJ_M) Ictalurus furcatus cDNA 5' similar to zebrafish RefSeq, XP_001339936.1, PREDICTED: similar to gastric mucin [Danio rerio], mRNA sequence.	mRNA	Ictalurus furcatus	FD156128	626
	CBZA38103.b1 CBZA: Normalized channel catfish cDNA library from stomach, muscle, olfactory tissue and trunk kidney (mixed tissue 2, AUL_M) Ictalurus punctatus cDNA 5' similar to zebrafish RefSeq, NP_998569.1, lipase, gastric [Danio rerio], mRNA sequence.	mRNA	Ictalurus punctatus	GH664522	787
	CBNI7810.b1 CBNI: Normalized channel catfish cDNA library from stomach, muscle, olfactory tissue and trunk kidney (mixed tissue 2, AUL) Ictalurus punctatus cDNA 5' similar to zebrafish RefSeq, NP_998569.1, lipase, gastric [Danio rerio], mRNA sequence.	mRNA	Ictalurus punctatus	FD021816	700
	CBFH5517.b1 CBFH: Normalized blue catfish cDNA library of stomach, muscle, olfactory tissue, and trunk kidney (mixed tissue 4, AUJ) Ictalurus furcatus cDNA 5' similar to zebrafish RefSeq, NP_998569.1, lipase, gastric [Danio rerio], mRNA sequence.	mRNA	Ictalurus furcatus	FD099047	314
	CBZC7267.b1 CBZC: Normalized blue catfish cDNA library from stomach, muscle, olfactory tissue and trunk kidney (mixed tissue 4, AUJ_M) Ictalurus furcatus cDNA 5' similar to zebrafish RefSeq, XP_001339936.1, PREDICTED: similar to gastric mucin [Danio rerio], mRNA sequence.	mRNA	Ictalurus furcatus	FD165522	778
	CBZC8782.g1 CBZC: Normalized blue catfish cDNA library from stomach, muscle, olfactory tissue and trunk kidney (mixed tissue 4, AUJ_M) Ictalurus furcatus cDNA 3' similar to zebrafish RefSeq, NP_998569.1, lipase, gastric [Danio rerio], mRNA sequence.	mRNA	Ictalurus furcatus	FD168194	790
	CBFH31957.b1 CBFH: Normalized blue catfish cDNA library of stomach, muscle, olfactory tissue, and trunk kidney (mixed tissue 4, AUJ) Ictalurus furcatus cDNA 5' similar to zebrafish RefSeq, NP_998569.1, lipase, gastric [Danio rerio], mRNA sequence.	mRNA	Ictalurus furcatus	FD093311	637
	CBZA38103.g1 CBZA: Normalized channel catfish cDNA library from stomach, muscle, olfactory tissue and trunk kidney (mixed tissue 2, AUL_M) Ictalurus punctatus cDNA 3' similar to zebrafish RefSeq, NP_998569.1, lipase, gastric [Danio rerio], mRNA sequence.	mRNA	Ictalurus punctatus	GH664523	814
	CBZC9276.b1 CBZC: Normalized blue catfish cDNA library from stomach, muscle, olfactory tissue and trunk kidney (mixed tissue 4, AUJ_M) Ictalurus furcatus cDNA 5' similar to zebrafish RefSeq, NP_998569.1, lipase, gastric [Danio rerio], mRNA sequence.	mRNA	Ictalurus furcatus	FD169108	138
	CBFH10490.b2 CBFH: Normalized blue catfish cDNA library of stomach, muscle, olfactory tissue, and trunk kidney (mixed tissue 4, AUJ) Ictalurus furcatus cDNA 5' similar to zebrafish RefSeq, NP_998569.1, lipase, gastric [Danio rerio], mRNA sequence.	mRNA	Ictalurus furcatus	FD067418	545
	Human mRNA for gastric lipase.	mRNA	Homo sapiens	X05997	1365
	H.sapiens mRNA for gastric mucin.	mRNA	Homo sapiens	X81649	2551
	JP 2006526998-A/1: Detection kit for gastric cancer and metastatic gastric cancer.	RNA	synthetic construct	DD459308	30
	JP 2006526998-A/9: Detection kit for gastric cancer and metastatic gastric cancer.	DNA	synthetic construct	DD459316	18
	JP 2006526998-A/17: Detection kit for gastric cancer and metastatic gastric cancer.	DNA	synthetic construct	DD459324	17
	JP 2006526998-A/25: Detection kit for gastric cancer and metastatic gastric cancer.	DNA	synthetic construct	DD459332	19
	JP 2006526998-A/33: Detection kit for gastric cancer and metastatic gastric cancer.	DNA	synthetic construct	DD459340	18
Now loading

ARSA (Search Result) Help

Search Condition

Advanced Search Quick Search

Search Settings

Search Condition

Quick Search Advanced Search

Available Fields

Search Result

Facet

List of Entries