ARSA (Search Result) Help

Search Condition

Quick Search

Available Fields

Field	Query Formats
Primary Accession Number	Search all wordsPrimaryAccessionNumber:(AB999999 AND AB999998 ...) Search any wordsPrimaryAccessionNumber:(AB999999 OR AB999999 ...) Regexp queryPrimaryAccessionNumber:/regexp/
Accession Number	Search all wordsAccessionNumber:(AB999999 AND AB888888 ...) Search any wordsAccessionNumber:(AB999999 OR AB888888 ...) Regexp queryAccessionNumber:/regexp/
Division	Search any divisionsDivision:(HUM OR PRI ...)
Sequence Length	Search rangingSequenceLength:[450 TO 500]
Molecular Type	Search any molecular typesMolecularType:(mRNA OR DNA ...)
Molecular Form	Search any molecular formsMolecularForm:(circular OR linear)
Date	Search rangingDate:[20090601 TO 20090701]
Definition	Search all wordsDefinition:(partial AND cds ...) Search any wordsDefinition:(partial OR cds ...) Regexp queryDefinition:/regexp/ Search exactly matchDefinition:"partial cds"
Comment	Search all wordsComment:(sequencing AND project ...) Search any wordsComment:(sequencing OR project ...) Regexp queryComment:/regexp/ Search exactly matchComment:"sequencing project"
Keyword	Search all wordsKeyword:(HTC AND HTC_FLI ...) Search any wordsKeyword:(HTC OR HTC_FLI ...) Regexp queryKeyword:/regexp/ Search exactly matchKeyword:"oligo capping"
Organism	Search all wordsOrganism:(Homo AND sapiens ...) Search any wordsOrganism:(Homo OR sapiens ...) Regexp queryOrganism:/regexp/ Search exactly matchOrganism:"Homo sapiens"
Lineage	Search all wordsLineage:(Eukaryota AND Metazoa ...) Search any wordsLineage:(Eukaryota OR Metazoa ...) Regexp queryLineage:/regexp/
Reference Author	Search all wordsReferenceAuthor:(Mishima AND Shizuoka ...) Search any wordsReferenceAuthor:(Mishima OR Shizuoka ...) Regexp queryReferenceAuthor:/regexp/ Search exactly matchReferenceAuthor:"Mishima,H."
Reference Title	Search all wordsReferenceTitle:(expressed AND liver ...) Search any wordsReferenceTitle:(expressed OR liver ...) Regexp queryReferenceTitle:/regexp/ Search exactly matchReferenceTitle:"expressed in human liver"
Reference Journal	Search all wordsReferenceJournal:(30-NOV-2008 AND Hanako ...) Search any wordsReferenceJournal:(30-NOV-2008 OR Hanako ...) Regexp queryReferenceJournal:/regexp/ Search exactly matchReferenceJournal:"Hanako Mishima"
Reference PubmedID	Search all wordsReferencePubmedID:(1111111 AND 1111112 ...) Search any wordsReferencePubmedID:(1111111 OR 1111112 ...) Regexp queryReferencePubmedID:/regexp/ Search rangingReferencePubmedID:[1111110 TO 1111119]
Feature	Search all wordsFeature:(GT200015 AND gt11 ...) Search any wordsFeature:(GT200015 OR gt11 ...) Search exactly matchFeature:"gene=\"GAPD\""
Feature Qualifier	Search one feature-qualifierFeatureQualifier:/source \/clone=GT200015/ Search all feature-qualifiersFeatureQualifier:(/source \/clone=GT200015/ AND /CDS \/gene=GAPD/ ...)
All Text	Search with field_name 'AllText'AllText:any_formats

LOCUS	AB000000 450 bp mRNA linear HUM 01-JUN-2009
DEFINITION	Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds.
ACCESSION	AB999999 AB888888 AB777777
VERSION	AB000000.1
KEYWORDS	HTC; HTC_FLI; oligo capping.
SOURCE	Homo sapiens (human)
ORGANISM	Homo sapiens
	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
	Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
	Catarrhini; Hominidae; Homo.
REFERENCE	1 (bases 1 to 450)
AUTHORS	Mishima,H. and Shizuoka,T.
TITLE	Direct Submission
JOURNAL	Submitted (30-NOV-2008) to the DDBJ/EMBL/GenBank databases. Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; Yata 1111, Mishima, Shizuoka 411-8540, Japan
PUBMED	1111111
REFERENCE	2
AUTHORS	Mishima,H., Shizuoka,T. and Fuji,I.
TITLE	Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver
JOURNAL	Unpublished (2009)
COMMENT	Human cDNA sequencing project.
FEATURES		Location/Qualifiers
source		1..450
source		/chromosome="12"
source		/clone="GT200015"
source		/clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)"
source		/db_xref="taxon:9606"
source		/map="12p13"
source		/mol_type="mRNA"
source		/organism="Homo sapiens"
source		/tissue_type="liver"
CDS		86..>450
CDS		/codon_start=1
CDS		/gene="GAPD"
CDS		/product="glyceraldehyde-3-phosphate dehydrogenase"
CDS		/protein_id="BAA12345.1"
CDS		/transl_table=1
CDS		/translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV"
BASE COUNT 102 a 119 c 131 g 98 t
ORIGIN
1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct
61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg
121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc
181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt
241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg
301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac
361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc
421 tcaacttaag ggtggtgcta agaaggtctg
//

Search Result

Facet

List of Entries

1 - entries / Number of founds: 74 FlatFile XML Fasta

	PrimaryAccessionNumber	Definition	SequenceLength	MolecularType	Organism
	C07650	Caenorhabditis elegans cDNA clone yk156b11 : 3' end, single read.	300	mRNA	Caenorhabditis elegans
	CP034458	Metschnikowia aff. pulcherrima strain APC 1.2 chromosome III, complete sequence.	2688662	DNA	Metschnikowia aff. pulcherrima
	CP042457	Kluyveromyces lactis strain CBS 2105 chromosome 3.	1761927	DNA	Kluyveromyces lactis
	CP019492	Zygosaccharomyces parabailii strain ATCC 60483 chromosome 3, complete sequence.	1751495	DNA	Zygosaccharomyces parabailii
	CP010070	Candidatus Methanoplasma termitum strain MpT1, complete genome.	1488669	DNA	Candidatus Methanoplasma termitum
	CP001710	Methanothermobacter marburgensis str. Marburg, complete genome.	1634695	DNA	Methanothermobacter marburgensis str. Marburg
	CP001698	Spirochaeta thermophila DSM 6192, complete genome.	2472645	DNA	Spirochaeta thermophila DSM 6192
	AP019757	Coxiella burnetii 406 DNA, complete genome.	1993917	DNA	Coxiella burnetii
	AP019759	Coxiella burnetii VS42 DNA, complete genome.	1995204	DNA	Coxiella burnetii
	CP003326	Gottschalkia acidurici 9a chromosome, complete genome.	3105335	DNA	Gottschalkia acidurici 9a
	CP005383	Mannheimia haemolytica M42548, complete genome.	2731870	DNA	Mannheimia haemolytica M42548
	CP002821	Oligotropha carboxidovorans OM4, complete genome.	3539447	DNA	Afipia carboxidovorans OM4
	CP003732	Thermacetogenium phaeum DSM 12270, complete genome.	2939057	DNA	Thermacetogenium phaeum DSM 12270
	CP004044	Thermoclostridium stercorarium subsp. stercorarium DSM 8532 chromosome, complete genome.	2974379	DNA	Thermoclostridium stercorarium subsp. stercorarium DSM 8532
	CP014170	Clostridium tyrobutyricum strain KCTC 5387 chromosome, complete genome.	3071606	DNA	Clostridium tyrobutyricum
	CP002409	Propionibacterium acnes 266, complete genome.	2494578	DNA	Cutibacterium acnes 266
	CP009170	Thermoanaerobacter kivui strain DSM 2030, complete genome.	2397824	DNA	Thermoanaerobacter kivui
	FR824043	Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069 complete chromosome sequence, strain ATCC BAA-2069.	2356444	DNA	Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
	CP003984	Planktomarina temperata RCA23, complete genome.	3288122	DNA	Planktomarina temperata RCA23
	CP004373	Gluconobacter oxydans DSM 3504, complete genome.	2882437	DNA	Gluconobacter oxydans DSM 3504
	CP007452	Peptoclostridium acidaminophilum DSM 3953 chromosome, complete genome.	2246262	DNA	Peptoclostridium acidaminophilum DSM 3953
	CP012369	Moorella thermoacetica strain DSM 521, complete genome.	2527564	DNA	Moorella thermoacetica
	CP002563	Carnobacterium sp. 17-4, complete genome.	2635294	DNA	Carnobacterium sp. 17-4
	CP012370	Moorella thermoacetica strain DSM 2955, complete genome.	2623349	DNA	Moorella thermoacetica
	CP023067	Ensifer sojae CCBAU 05684 chromosome, complete genome.	3672259	DNA	Ensifer sojae CCBAU 05684
	CP002826	Oligotropha carboxidovorans OM5, complete genome.	3595748	DNA	Afipia carboxidovorans OM5
	CP001962	Thermus scotoductus SA-01, complete genome.	2346803	DNA	Thermus scotoductus SA-01
	AP018538	Enterococcus faecalis KUB3006 DNA, complete genome.	2893216	DNA	Enterococcus faecalis
	CP003203	Arthrobacter sp. Rue61a, complete genome.	4736495	DNA	Arthrobacter sp. Rue61a
	CP002972	Phaeobacter inhibens 2.10 chromosome, complete genome.	3758274	DNA	Phaeobacter inhibens 2.10
Now loading

PAGE TOP