ARSA (Search Result) Help

Search Condition

Quick Search

Available Fields

Field	Query Formats
Primary Accession Number	Search all wordsPrimaryAccessionNumber:(AB999999 AND AB999998 ...) Search any wordsPrimaryAccessionNumber:(AB999999 OR AB999999 ...) Regexp queryPrimaryAccessionNumber:/regexp/
Accession Number	Search all wordsAccessionNumber:(AB999999 AND AB888888 ...) Search any wordsAccessionNumber:(AB999999 OR AB888888 ...) Regexp queryAccessionNumber:/regexp/
Division	Search any divisionsDivision:(HUM OR PRI ...)
Sequence Length	Search rangingSequenceLength:[450 TO 500]
Molecular Type	Search any molecular typesMolecularType:(mRNA OR DNA ...)
Molecular Form	Search any molecular formsMolecularForm:(circular OR linear)
Date	Search rangingDate:[20090601 TO 20090701]
Definition	Search all wordsDefinition:(partial AND cds ...) Search any wordsDefinition:(partial OR cds ...) Regexp queryDefinition:/regexp/ Search exactly matchDefinition:"partial cds"
Comment	Search all wordsComment:(sequencing AND project ...) Search any wordsComment:(sequencing OR project ...) Regexp queryComment:/regexp/ Search exactly matchComment:"sequencing project"
Keyword	Search all wordsKeyword:(HTC AND HTC_FLI ...) Search any wordsKeyword:(HTC OR HTC_FLI ...) Regexp queryKeyword:/regexp/ Search exactly matchKeyword:"oligo capping"
Organism	Search all wordsOrganism:(Homo AND sapiens ...) Search any wordsOrganism:(Homo OR sapiens ...) Regexp queryOrganism:/regexp/ Search exactly matchOrganism:"Homo sapiens"
Lineage	Search all wordsLineage:(Eukaryota AND Metazoa ...) Search any wordsLineage:(Eukaryota OR Metazoa ...) Regexp queryLineage:/regexp/
Reference Author	Search all wordsReferenceAuthor:(Mishima AND Shizuoka ...) Search any wordsReferenceAuthor:(Mishima OR Shizuoka ...) Regexp queryReferenceAuthor:/regexp/ Search exactly matchReferenceAuthor:"Mishima,H."
Reference Title	Search all wordsReferenceTitle:(expressed AND liver ...) Search any wordsReferenceTitle:(expressed OR liver ...) Regexp queryReferenceTitle:/regexp/ Search exactly matchReferenceTitle:"expressed in human liver"
Reference Journal	Search all wordsReferenceJournal:(30-NOV-2008 AND Hanako ...) Search any wordsReferenceJournal:(30-NOV-2008 OR Hanako ...) Regexp queryReferenceJournal:/regexp/ Search exactly matchReferenceJournal:"Hanako Mishima"
Reference PubmedID	Search all wordsReferencePubmedID:(1111111 AND 1111112 ...) Search any wordsReferencePubmedID:(1111111 OR 1111112 ...) Regexp queryReferencePubmedID:/regexp/ Search rangingReferencePubmedID:[1111110 TO 1111119]
Feature	Search all wordsFeature:(GT200015 AND gt11 ...) Search any wordsFeature:(GT200015 OR gt11 ...) Search exactly matchFeature:"gene=\"GAPD\""
Feature Qualifier	Search one feature-qualifierFeatureQualifier:/source \/clone=GT200015/ Search all feature-qualifiersFeatureQualifier:(/source \/clone=GT200015/ AND /CDS \/gene=GAPD/ ...)
All Text	Search with field_name 'AllText'AllText:any_formats

LOCUS	AB000000 450 bp mRNA linear HUM 01-JUN-2009
DEFINITION	Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds.
ACCESSION	AB999999 AB888888 AB777777
VERSION	AB000000.1
KEYWORDS	HTC; HTC_FLI; oligo capping.
SOURCE	Homo sapiens (human)
ORGANISM	Homo sapiens
	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
	Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
	Catarrhini; Hominidae; Homo.
REFERENCE	1 (bases 1 to 450)
AUTHORS	Mishima,H. and Shizuoka,T.
TITLE	Direct Submission
JOURNAL	Submitted (30-NOV-2008) to the DDBJ/EMBL/GenBank databases. Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; Yata 1111, Mishima, Shizuoka 411-8540, Japan
PUBMED	1111111
REFERENCE	2
AUTHORS	Mishima,H., Shizuoka,T. and Fuji,I.
TITLE	Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver
JOURNAL	Unpublished (2009)
COMMENT	Human cDNA sequencing project.
FEATURES		Location/Qualifiers
source		1..450
source		/chromosome="12"
source		/clone="GT200015"
source		/clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)"
source		/db_xref="taxon:9606"
source		/map="12p13"
source		/mol_type="mRNA"
source		/organism="Homo sapiens"
source		/tissue_type="liver"
CDS		86..>450
CDS		/codon_start=1
CDS		/gene="GAPD"
CDS		/product="glyceraldehyde-3-phosphate dehydrogenase"
CDS		/protein_id="BAA12345.1"
CDS		/transl_table=1
CDS		/translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV"
BASE COUNT 102 a 119 c 131 g 98 t
ORIGIN
1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct
61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg
121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc
181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt
241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg
301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac
361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc
421 tcaacttaag ggtggtgcta agaaggtctg
//

Search Result

Facet

List of Entries

1 - entries / Number of founds: 40 FlatFile XML Fasta

	PrimaryAccessionNumber	Definition	SequenceLength	MolecularType	Organism
	C10796	Caenorhabditis elegans cDNA clone yk154a8 : 3' end, single read.	300	mRNA	Caenorhabditis elegans
	AU092116	Oryza sativa Japonica Group cDNA, partial sequence (C10796_8Z).	318	mRNA	Oryza sativa Japonica Group
	MH134740	Influenza A virus (A/environment/Chile/C10796/2016(H16N3)) segment 6 neuraminidase (NA) gene, complete cds.	1452	cRNA	Influenza A virus
	MH134811	Influenza A virus (A/environment/Chile/C10796/2016(H16N3)) segment 1 polymerase PB2 (PB2) gene, complete cds.	2328	cRNA	Influenza A virus
	MH134671	Influenza A virus (A/environment/Chile/C10796/2016(H16N3)) segment 5 nucleocapsid protein (NP) gene, complete cds.	1566	cRNA	Influenza A virus
	LA787491	TSA: Monomorium pharaonis mRNA, contig: c10796_g1_i1.	379	mRNA	Monomorium pharaonis
	C25829	Oryza sativa Japonica Group cDNA, partial sequence (C10796_1A).	382	mRNA	Oryza sativa Japonica Group
	JT567504	TSA: Eustoma exaltatum subsp. russellianum E_gra_c10796 mRNA sequence.	437	mRNA	Eustoma exaltatum subsp. russellianum
	MH134803	Influenza A virus (A/environment/Chile/C10796/2016(H16N3)) segment 3 polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds.	2233	cRNA	Influenza A virus
	MH134799	Influenza A virus (A/environment/Chile/C10796/2016(H16N3)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds.	890	cRNA	Influenza A virus
	FX156373	TSA: Schima mertensiana mRNA, contig: Sm_c10796.	708	mRNA	Schima mertensiana
	HO820474	vsubiol_024189_74509.9_c10796 vsubiol_013396_74509.9 Dioscorea alata cDNA, mRNA sequence.	273	mRNA	Dioscorea alata
	JP173422	TSA: Stylophora pistillata allreg_c10796 mRNA sequence.	731	mRNA	Stylophora pistillata
	HO861410	vsubiol_010789_96561.1_c10796 vsubiol_000001_96561.1 Dioscorea alata cDNA, mRNA sequence.	201	mRNA	Dioscorea alata
	FX126892	TSA: Calophyllum inophyllum mRNA, contig: Ci_c10796.	429	mRNA	Calophyllum inophyllum
	MH134833	Influenza A virus (A/environment/Chile/C10796/2016(H16N3)) segment 4 hemagglutinin (HA) gene, complete cds.	1758	cRNA	Influenza A virus
	FX172546	TSA: Pandanus boninensis mRNA, contig: Pb_c10796.	664	mRNA	Pandanus boninensis
	HO410357	chlorokybus_71836.3_c10796_c Chlorokybus atmophyticus EST library Chlorokybus atmophyticus cDNA 5', mRNA sequence.	882	mRNA	Chlorokybus atmophyticus
	HO469908	klebsormidium_60434_c10796_c Klebsormidium flaccidum EST library Klebsormidium flaccidum cDNA 5', mRNA sequence.	450	mRNA	Klebsormidium flaccidum
	FX144691	TSA: Elaeocarpus photiniifolius mRNA, contig: Ep_c10796.	511	mRNA	Elaeocarpus photiniifolius
	MH134735	Influenza A virus (A/environment/Chile/C10796/2016(H16N3)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds.	1027	cRNA	Influenza A virus
	MH134838	Influenza A virus (A/environment/Chile/C10796/2016(H16N3)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds.	2341	cRNA	Influenza A virus
	HO576206	penium_71836_c10796_c Penium margaritaceum EST library Penium margaritaceum cDNA 5', mRNA sequence.	1109	mRNA	Penium margaritaceum
	KA290132	TSA: Camellia sinensis tea_c10796 mRNA sequence.	946	mRNA	Camellia sinensis
	HO543236	nitella_74953_c10796_c Nitella hyalina EST library Nitella hyalina cDNA 5', mRNA sequence.	544	mRNA	Nitella hyalina
	EZ467235	TSA: Mustela putorius furo Ferret_c10796, complete sequence, mRNA sequence.	368	mRNA	Mustela putorius furo
	JU374586	TSA: Scophthalmus maximus Pmax_rep_c10796 mRNA sequence.	774	mRNA	Scophthalmus maximus
	EZ925977	TSA: Anopheles funestus cmb2_c10796 mRNA sequence.	243	mRNA	Anopheles funestus
	HO836217	vsubiol_039932_74509.8_c10796 vsubiol_029137_74509.8 Dioscorea alata cDNA, mRNA sequence.	223	mRNA	Dioscorea alata
	JO200967	TSA: Chlorokybus atmophyticus strain UTEX 2591 chatm_c10796_c_s mRNA sequence.	882	mRNA	Chlorokybus atmophyticus
Now loading

PAGE TOP