ARSA (Search Result) Help

Search Condition

Quick Search

Available Fields

Field	Query Formats
Primary Accession Number	Search all wordsPrimaryAccessionNumber:(AB999999 AND AB999998 ...) Search any wordsPrimaryAccessionNumber:(AB999999 OR AB999999 ...) Regexp queryPrimaryAccessionNumber:/regexp/
Accession Number	Search all wordsAccessionNumber:(AB999999 AND AB888888 ...) Search any wordsAccessionNumber:(AB999999 OR AB888888 ...) Regexp queryAccessionNumber:/regexp/
Division	Search any divisionsDivision:(HUM OR PRI ...)
Sequence Length	Search rangingSequenceLength:[450 TO 500]
Molecular Type	Search any molecular typesMolecularType:(mRNA OR DNA ...)
Molecular Form	Search any molecular formsMolecularForm:(circular OR linear)
Date	Search rangingDate:[20090601 TO 20090701]
Definition	Search all wordsDefinition:(partial AND cds ...) Search any wordsDefinition:(partial OR cds ...) Regexp queryDefinition:/regexp/ Search exactly matchDefinition:"partial cds"
Comment	Search all wordsComment:(sequencing AND project ...) Search any wordsComment:(sequencing OR project ...) Regexp queryComment:/regexp/ Search exactly matchComment:"sequencing project"
Keyword	Search all wordsKeyword:(HTC AND HTC_FLI ...) Search any wordsKeyword:(HTC OR HTC_FLI ...) Regexp queryKeyword:/regexp/ Search exactly matchKeyword:"oligo capping"
Organism	Search all wordsOrganism:(Homo AND sapiens ...) Search any wordsOrganism:(Homo OR sapiens ...) Regexp queryOrganism:/regexp/ Search exactly matchOrganism:"Homo sapiens"
Lineage	Search all wordsLineage:(Eukaryota AND Metazoa ...) Search any wordsLineage:(Eukaryota OR Metazoa ...) Regexp queryLineage:/regexp/
Reference Author	Search all wordsReferenceAuthor:(Mishima AND Shizuoka ...) Search any wordsReferenceAuthor:(Mishima OR Shizuoka ...) Regexp queryReferenceAuthor:/regexp/ Search exactly matchReferenceAuthor:"Mishima,H."
Reference Title	Search all wordsReferenceTitle:(expressed AND liver ...) Search any wordsReferenceTitle:(expressed OR liver ...) Regexp queryReferenceTitle:/regexp/ Search exactly matchReferenceTitle:"expressed in human liver"
Reference Journal	Search all wordsReferenceJournal:(30-NOV-2008 AND Hanako ...) Search any wordsReferenceJournal:(30-NOV-2008 OR Hanako ...) Regexp queryReferenceJournal:/regexp/ Search exactly matchReferenceJournal:"Hanako Mishima"
Reference PubmedID	Search all wordsReferencePubmedID:(1111111 AND 1111112 ...) Search any wordsReferencePubmedID:(1111111 OR 1111112 ...) Regexp queryReferencePubmedID:/regexp/ Search rangingReferencePubmedID:[1111110 TO 1111119]
Feature	Search all wordsFeature:(GT200015 AND gt11 ...) Search any wordsFeature:(GT200015 OR gt11 ...) Search exactly matchFeature:"gene=\"GAPD\""
Feature Qualifier	Search one feature-qualifierFeatureQualifier:/source \/clone=GT200015/ Search all feature-qualifiersFeatureQualifier:(/source \/clone=GT200015/ AND /CDS \/gene=GAPD/ ...)
All Text	Search with field_name 'AllText'AllText:any_formats

LOCUS	AB000000 450 bp mRNA linear HUM 01-JUN-2009
DEFINITION	Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds.
ACCESSION	AB999999 AB888888 AB777777
VERSION	AB000000.1
KEYWORDS	HTC; HTC_FLI; oligo capping.
SOURCE	Homo sapiens (human)
ORGANISM	Homo sapiens
	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
	Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
	Catarrhini; Hominidae; Homo.
REFERENCE	1 (bases 1 to 450)
AUTHORS	Mishima,H. and Shizuoka,T.
TITLE	Direct Submission
JOURNAL	Submitted (30-NOV-2008) to the DDBJ/EMBL/GenBank databases. Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; Yata 1111, Mishima, Shizuoka 411-8540, Japan
PUBMED	1111111
REFERENCE	2
AUTHORS	Mishima,H., Shizuoka,T. and Fuji,I.
TITLE	Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver
JOURNAL	Unpublished (2009)
COMMENT	Human cDNA sequencing project.
FEATURES		Location/Qualifiers
source		1..450
source		/chromosome="12"
source		/clone="GT200015"
source		/clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)"
source		/db_xref="taxon:9606"
source		/map="12p13"
source		/mol_type="mRNA"
source		/organism="Homo sapiens"
source		/tissue_type="liver"
CDS		86..>450
CDS		/codon_start=1
CDS		/gene="GAPD"
CDS		/product="glyceraldehyde-3-phosphate dehydrogenase"
CDS		/protein_id="BAA12345.1"
CDS		/transl_table=1
CDS		/translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV"
BASE COUNT 102 a 119 c 131 g 98 t
ORIGIN
1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct
61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg
121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc
181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt
241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg
301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac
361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc
421 tcaacttaag ggtggtgcta agaaggtctg
//

Search Result

Facet

List of Entries

1 - entries / Number of founds: 26 FlatFile XML Fasta

	PrimaryAccessionNumber	Definition	SequenceLength	MolecularType	Organism
	C31271	Caenorhabditis elegans cDNA clone yk274d11 : 3' end, single read.	300	mRNA	Caenorhabditis elegans
	LA811725	TSA: Monomorium pharaonis mRNA, contig: c31271_g1_i1.	264	mRNA	Monomorium pharaonis
	LI511388	TSA: Lasius neglectus mRNA, contig: c31271.graph_c1_seq2.	1893	mRNA	Lasius neglectus
	LI511389	TSA: Lasius neglectus mRNA, contig: c31271.graph_c1_seq3.	2026	mRNA	Lasius neglectus
	LI511386	TSA: Lasius neglectus mRNA, contig: c31271.graph_c0_seq1.	248	mRNA	Lasius neglectus
	OP888697	Influenza A virus (A/yellow-billed teal/Chile/C31271/2017(H11N9)) segment 6 neuraminidase (NA) gene, complete cds.	1460	cRNA	Influenza A virus
	LA811726	TSA: Monomorium pharaonis mRNA, contig: c31271_g2_i1.	536	mRNA	Monomorium pharaonis
	LI511387	TSA: Lasius neglectus mRNA, contig: c31271.graph_c1_seq1.	2108	mRNA	Lasius neglectus
	JT587952	TSA: Eustoma exaltatum subsp. russellianum E_gra_c31271 mRNA sequence.	460	mRNA	Eustoma exaltatum subsp. russellianum
	LT241787	Spodoptera frugiperda genome assembly, scaffold: C31271.	102	DNA	Spodoptera frugiperda
	OP888695	Influenza A virus (A/yellow-billed teal/Chile/C31271/2017(H11N9)) segment 4 hemagglutinin (HA) gene, complete cds.	1760	cRNA	Influenza A virus
	HO380922	chaetospheridium_74953.1_c31271_c Chaetosphaeridium globosum EST library Chaetosphaeridium globosum cDNA 5', mRNA sequence.	212	mRNA	Chaetosphaeridium globosum
	EZ487710	TSA: Mustela putorius furo Ferret_c31271, complete sequence, mRNA sequence.	229	mRNA	Mustela putorius furo
	OP888696	Influenza A virus (A/yellow-billed teal/Chile/C31271/2017(H11N9)) segment 5 nucleocapsid protein (NP) gene, complete cds.	1565	cRNA	Influenza A virus
	HO633648	penium_71836_c31271_c Penium margaritaceum EST library Penium margaritaceum cDNA 5', mRNA sequence.	216	mRNA	Penium margaritaceum
	JP200293	TSA: Stylophora pistillata allreg_c31271 mRNA sequence.	738	mRNA	Stylophora pistillata
	JU361609	TSA: Scophthalmus maximus Pmax_c31271 mRNA sequence.	464	mRNA	Scophthalmus maximus
	JO912936	TSA: Aedes albopictus Aalb_oocyte_c31271 mRNA sequence.	462	mRNA	Aedes albopictus
	OP888693	Influenza A virus (A/yellow-billed teal/Chile/C31271/2017(H11N9)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds.	2341	cRNA	Influenza A virus
	OP888698	Influenza A virus (A/yellow-billed teal/Chile/C31271/2017(H11N9)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds.	1027	cRNA	Influenza A virus
	OP888692	Influenza A virus (A/yellow-billed teal/Chile/C31271/2017(H11N9)) segment 1 polymerase PB2 (PB2) gene, complete cds.	2341	cRNA	Influenza A virus
	HO454719	klebsormidium_60434_c31271_c Klebsormidium flaccidum EST library Klebsormidium flaccidum cDNA 5', mRNA sequence.	206	mRNA	Klebsormidium flaccidum
	OP888694	Influenza A virus (A/yellow-billed teal/Chile/C31271/2017(H11N9)) segment 3 polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds.	2233	cRNA	Influenza A virus
	OP888699	Influenza A virus (A/yellow-billed teal/Chile/C31271/2017(H11N9)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds.	890	cRNA	Influenza A virus
	HP031245	TSA: Arachis duranensis DurSNP_c31271.Ardu mRNA sequence.	326	mRNA	Arachis duranensis
	JO269524	TSA: Klebsormidium flaccidum strain UTEX 321 kfla_c31271_c mRNA sequence.	206	mRNA	Klebsormidium flaccidum
Now loading

PAGE TOP