ARSA (Search Result) Help

Search Condition

Quick Search

Available Fields

Field	Query Formats
Primary Accession Number	Search all wordsPrimaryAccessionNumber:(AB999999 AND AB999998 ...) Search any wordsPrimaryAccessionNumber:(AB999999 OR AB999999 ...) Regexp queryPrimaryAccessionNumber:/regexp/
Accession Number	Search all wordsAccessionNumber:(AB999999 AND AB888888 ...) Search any wordsAccessionNumber:(AB999999 OR AB888888 ...) Regexp queryAccessionNumber:/regexp/
Division	Search any divisionsDivision:(HUM OR PRI ...)
Sequence Length	Search rangingSequenceLength:[450 TO 500]
Molecular Type	Search any molecular typesMolecularType:(mRNA OR DNA ...)
Molecular Form	Search any molecular formsMolecularForm:(circular OR linear)
Date	Search rangingDate:[20090601 TO 20090701]
Definition	Search all wordsDefinition:(partial AND cds ...) Search any wordsDefinition:(partial OR cds ...) Regexp queryDefinition:/regexp/ Search exactly matchDefinition:"partial cds"
Comment	Search all wordsComment:(sequencing AND project ...) Search any wordsComment:(sequencing OR project ...) Regexp queryComment:/regexp/ Search exactly matchComment:"sequencing project"
Keyword	Search all wordsKeyword:(HTC AND HTC_FLI ...) Search any wordsKeyword:(HTC OR HTC_FLI ...) Regexp queryKeyword:/regexp/ Search exactly matchKeyword:"oligo capping"
Organism	Search all wordsOrganism:(Homo AND sapiens ...) Search any wordsOrganism:(Homo OR sapiens ...) Regexp queryOrganism:/regexp/ Search exactly matchOrganism:"Homo sapiens"
Lineage	Search all wordsLineage:(Eukaryota AND Metazoa ...) Search any wordsLineage:(Eukaryota OR Metazoa ...) Regexp queryLineage:/regexp/
Reference Author	Search all wordsReferenceAuthor:(Mishima AND Shizuoka ...) Search any wordsReferenceAuthor:(Mishima OR Shizuoka ...) Regexp queryReferenceAuthor:/regexp/ Search exactly matchReferenceAuthor:"Mishima,H."
Reference Title	Search all wordsReferenceTitle:(expressed AND liver ...) Search any wordsReferenceTitle:(expressed OR liver ...) Regexp queryReferenceTitle:/regexp/ Search exactly matchReferenceTitle:"expressed in human liver"
Reference Journal	Search all wordsReferenceJournal:(30-NOV-2008 AND Hanako ...) Search any wordsReferenceJournal:(30-NOV-2008 OR Hanako ...) Regexp queryReferenceJournal:/regexp/ Search exactly matchReferenceJournal:"Hanako Mishima"
Reference PubmedID	Search all wordsReferencePubmedID:(1111111 AND 1111112 ...) Search any wordsReferencePubmedID:(1111111 OR 1111112 ...) Regexp queryReferencePubmedID:/regexp/ Search rangingReferencePubmedID:[1111110 TO 1111119]
Feature	Search all wordsFeature:(GT200015 AND gt11 ...) Search any wordsFeature:(GT200015 OR gt11 ...) Search exactly matchFeature:"gene=\"GAPD\""
Feature Qualifier	Search one feature-qualifierFeatureQualifier:/source \/clone=GT200015/ Search all feature-qualifiersFeatureQualifier:(/source \/clone=GT200015/ AND /CDS \/gene=GAPD/ ...)
All Text	Search with field_name 'AllText'AllText:any_formats

LOCUS	AB000000 450 bp mRNA linear HUM 01-JUN-2009
DEFINITION	Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds.
ACCESSION	AB999999 AB888888 AB777777
VERSION	AB000000.1
KEYWORDS	HTC; HTC_FLI; oligo capping.
SOURCE	Homo sapiens (human)
ORGANISM	Homo sapiens
	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
	Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
	Catarrhini; Hominidae; Homo.
REFERENCE	1 (bases 1 to 450)
AUTHORS	Mishima,H. and Shizuoka,T.
TITLE	Direct Submission
JOURNAL	Submitted (30-NOV-2008) to the DDBJ/EMBL/GenBank databases. Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; Yata 1111, Mishima, Shizuoka 411-8540, Japan
PUBMED	1111111
REFERENCE	2
AUTHORS	Mishima,H., Shizuoka,T. and Fuji,I.
TITLE	Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver
JOURNAL	Unpublished (2009)
COMMENT	Human cDNA sequencing project.
FEATURES		Location/Qualifiers
source		1..450
source		/chromosome="12"
source		/clone="GT200015"
source		/clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)"
source		/db_xref="taxon:9606"
source		/map="12p13"
source		/mol_type="mRNA"
source		/organism="Homo sapiens"
source		/tissue_type="liver"
CDS		86..>450
CDS		/codon_start=1
CDS		/gene="GAPD"
CDS		/product="glyceraldehyde-3-phosphate dehydrogenase"
CDS		/protein_id="BAA12345.1"
CDS		/transl_table=1
CDS		/translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV"
BASE COUNT 102 a 119 c 131 g 98 t
ORIGIN
1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct
61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg
121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc
181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt
241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg
301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac
361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc
421 tcaacttaag ggtggtgcta agaaggtctg
//

Search Result

Facet

List of Entries

1 - entries / Number of founds: 18 FlatFile XML Fasta

	PrimaryAccessionNumber	Definition	SequenceLength	MolecularType	Organism
	FF102926	CPAD-aad06h06.b1 PB2801_EST_CPAD1 Caenorhabditis brenneri cDNA similar to ref\|NP_510484.1\| Putative N-myristoylated membrane protein, with a transmembrane domain, of bilaterial origin (17.6 kD) [Caenorhabditis elegans] pir\|T21142 hypothetical protein F20D1.1 - Caenorhabditis elegans emb\|CAB01743.1\| Hypothetical protein, mRNA sequence.	760	mRNA	Caenorhabditis brenneri
	FF108975	CJAD-aaa12f04.b2 Caenorhabditis_japonica_EST_CJAD1 Caenorhabditis japonica cDNA similar to ref\|NP_510484.1\| Putative N-myristoylated membrane protein, with a transmembrane domain, of bilaterial origin (17.6 kD) [Caenorhabditis elegans] pir\|T21142 hypothetical protein F20D1.1 - Caenorhabditis elegans emb\|CAB01743.1\| Hypothetical protein, mRNA sequence.	679	mRNA	Caenorhabditis japonica
	EX556976	AIAE-aaa99g08.g1 Ancylostoma_caninum_EST_Female_pSMART Ancylostoma caninum cDNA similar to ref\|NP_510484.1\| Putative N-myristoylated membrane protein, with a transmembrane domain, of bilaterial origin (17.6 kD) [Caenorhabditis elegans] pir\|T21142 hypothetical protein F20D1.1 - Caenorhabditis elegans emb\|CAB01743.1\| Hypothetical protein, mRNA sequence.	473	mRNA	Ancylostoma caninum
	FF107601	CPAD-aad08f03.b1 PB2801_EST_CPAD1 Caenorhabditis brenneri cDNA similar to ref\|NP_510484.1\| Putative N-myristoylated membrane protein, with a transmembrane domain, of bilaterial origin (17.6 kD) [Caenorhabditis elegans] pir\|T21142 hypothetical protein F20D1.1 - Caenorhabditis elegans emb\|CAB01743.1\| Hypothetical protein, mRNA sequence.	462	mRNA	Caenorhabditis brenneri
	EX013469	HTAB-aad57h04.b1 Heterorhabditis_bacteriophora_HTAB2_EST Heterorhabditis bacteriophora cDNA similar to ref\|NP_510484.1\| Putative N-myristoylated membrane protein, with a transmembrane domain, of bilaterial origin (17.6 kD) [Caenorhabditis elegans] pir\|T21142 hypothetical protein F20D1.1 - Caenorhabditis elegans emb\|CAB01743.1\| Hypothetical protein, mRNA sequence.	712	mRNA	Heterorhabditis bacteriophora
	FF108714	CPAD-aad20c12.b1 PB2801_EST_CPAD1 Caenorhabditis brenneri cDNA similar to ref\|NP_510484.1\| Putative N-myristoylated membrane protein, with a transmembrane domain, of bilaterial origin (17.6 kD) [Caenorhabditis elegans] pir\|T21142 hypothetical protein F20D1.1 - Caenorhabditis elegans emb\|CAB01743.1\| Hypothetical protein, mRNA sequence.	672	mRNA	Caenorhabditis brenneri
	EX545402	AIAC-aab22h03.b1 Ancylostoma_caninum_EST_Male_pSMART Ancylostoma caninum cDNA similar to ref\|NP_510484.1\| Putative N-myristoylated membrane protein, with a transmembrane domain, of bilaterial origin (17.6 kD) [Caenorhabditis elegans] pir\|T21142 hypothetical protein F20D1.1 - Caenorhabditis elegans emb\|CAB01743.1\| Hypothetical protein, mRNA sequence.	345	mRNA	Ancylostoma caninum
	EX913689	HTAB-aae80g01.b1 Heterorhabditis_bacteriophora_HTAB2_EST Heterorhabditis bacteriophora cDNA similar to ref\|NP_510484.1\| Putative N-myristoylated membrane protein, with a transmembrane domain, of bilaterial origin (17.6 kD) [Caenorhabditis elegans] pir\|T21142 hypothetical protein F20D1.1 - Caenorhabditis elegans emb\|CAB01743.1\| Hypothetical protein, mRNA sequence.	614	mRNA	Heterorhabditis bacteriophora
	EX564457	AIAE-aab19g02.b1 Ancylostoma_caninum_EST_Female_pSMART Ancylostoma caninum cDNA similar to ref\|NP_510484.1\| Putative N-myristoylated membrane protein, with a transmembrane domain, of bilaterial origin (17.6 kD) [Caenorhabditis elegans] pir\|T21142 hypothetical protein F20D1.1 - Caenorhabditis elegans emb\|CAB01743.1\| Hypothetical protein, mRNA sequence.	253	mRNA	Ancylostoma caninum
	EX913242	HTAB-aad91e07.b1 Heterorhabditis_bacteriophora_HTAB2_EST Heterorhabditis bacteriophora cDNA similar to ref\|NP_510484.1\| Putative N-myristoylated membrane protein, with a transmembrane domain, of bilaterial origin (17.6 kD) [Caenorhabditis elegans] pir\|T21142 hypothetical protein F20D1.1 - Caenorhabditis elegans emb\|CAB01743.1\| Hypothetical protein, mRNA sequence.	664	mRNA	Heterorhabditis bacteriophora
	FF104780	CPAD-aad54d03.b1 PB2801_EST_CPAD1 Caenorhabditis brenneri cDNA similar to ref\|NP_510484.1\| Putative N-myristoylated membrane protein, with a transmembrane domain, of bilaterial origin (17.6 kD) [Caenorhabditis elegans] pir\|T21142 hypothetical protein F20D1.1 - Caenorhabditis elegans emb\|CAB01743.1\| Hypothetical protein, mRNA sequence.	641	mRNA	Caenorhabditis brenneri
	FF110551	CJAH-aaa74b04.b2 Caenorhabditis_japonica_CJAH1_EST_5081 Caenorhabditis japonica cDNA similar to ref\|NP_510484.1\| Putative N-myristoylated membrane protein, with a transmembrane domain, of bilaterial origin (17.6 kD) [Caenorhabditis elegans] pir\|T21142 hypothetical protein F20D1.1 - Caenorhabditis elegans emb\|CAB01743.1\| Hypothetical protein, mRNA sequence.	778	mRNA	Caenorhabditis japonica
	ES744376	HTAB-aab33d12.b1 Heterorhabditis_bacteriophora_HTAB2_EST Heterorhabditis bacteriophora cDNA similar to ref\|NP_510484.1\| Putative N-myristoylated membrane protein, with a transmembrane domain, of bilaterial origin (17.6 kD) [Caenorhabditis elegans] pir\|T21142 hypothetical protein F20D1.1 - Caenorhabditis elegans emb\|CAB01743.1\| Hypothetical protein, mRNA sequence.	632	mRNA	Heterorhabditis bacteriophora
	EX911371	HTAB-aae53b04.b1 Heterorhabditis_bacteriophora_HTAB2_EST Heterorhabditis bacteriophora cDNA similar to ref\|NP_510484.1\| Putative N-myristoylated membrane protein, with a transmembrane domain, of bilaterial origin (17.6 kD) [Caenorhabditis elegans] pir\|T21142 hypothetical protein F20D1.1 - Caenorhabditis elegans emb\|CAB01743.1\| Hypothetical protein, mRNA sequence.	634	mRNA	Heterorhabditis bacteriophora
	DY525760	BAAC-PNP1305B14.g1 C.remanei EST SB146 Caenorhabditis remanei cDNA 5' similar to ref\|NP_510484.1\| Putative N-myristoylated membrane protein, with a transmembrane domain, of bilaterial origin (17.6 kD) [Caenorhabditis elegans] pir\|\|T21142 hypothetical protein F20D1.1 - Caenorhabditis elegans emb\|CAB01743.1\| Hypothetical protein, mRNA sequence.	776	mRNA	Caenorhabditis remanei
	EB390646	NPAC-aaa07c09.g2 N.brasiliensis_EST_L3N_SL1 Nippostrongylus brasiliensis cDNA similar to ref\|NP_510484.1\| Putative N-myristoylated membrane protein, with a transmembrane domain, of bilaterial origin (17.6 kD) [Caenorhabditis elegans] pir\|T21142 hypothetical protein F20D1.1 - Caenorhabditis elegans emb\|CAB01743.1\| Hypothetical protein, mRNA sequence.	585	mRNA	Nippostrongylus brasiliensis
	EB186336	NPAC-aaa07c09.b1 N.brasiliensis_EST_L3N_SL1 Nippostrongylus brasiliensis cDNA similar to ref\|NP_510484.1\| Putative N-myristoylated membrane protein, with a transmembrane domain, of bilaterial origin (17.6 kD) [Caenorhabditis elegans] pir\|T21142 hypothetical protein F20D1.1 - Caenorhabditis elegans emb\|CAB01743.1\| Hypothetical protein, mRNA sequence.	606	mRNA	Nippostrongylus brasiliensis
	BX284606	Caenorhabditis elegans chromosome X.	17718942	DNA	Caenorhabditis elegans
Now loading

PAGE TOP