ARSA (Search Result) Help

Search Condition

Quick Search

Available Fields

Field	Query Formats
Primary Accession Number	Search all wordsPrimaryAccessionNumber:(AB999999 AND AB999998 ...) Search any wordsPrimaryAccessionNumber:(AB999999 OR AB999999 ...) Regexp queryPrimaryAccessionNumber:/regexp/
Accession Number	Search all wordsAccessionNumber:(AB999999 AND AB888888 ...) Search any wordsAccessionNumber:(AB999999 OR AB888888 ...) Regexp queryAccessionNumber:/regexp/
Division	Search any divisionsDivision:(HUM OR PRI ...)
Sequence Length	Search rangingSequenceLength:[450 TO 500]
Molecular Type	Search any molecular typesMolecularType:(mRNA OR DNA ...)
Molecular Form	Search any molecular formsMolecularForm:(circular OR linear)
Date	Search rangingDate:[20090601 TO 20090701]
Definition	Search all wordsDefinition:(partial AND cds ...) Search any wordsDefinition:(partial OR cds ...) Regexp queryDefinition:/regexp/ Search exactly matchDefinition:"partial cds"
Comment	Search all wordsComment:(sequencing AND project ...) Search any wordsComment:(sequencing OR project ...) Regexp queryComment:/regexp/ Search exactly matchComment:"sequencing project"
Keyword	Search all wordsKeyword:(HTC AND HTC_FLI ...) Search any wordsKeyword:(HTC OR HTC_FLI ...) Regexp queryKeyword:/regexp/ Search exactly matchKeyword:"oligo capping"
Organism	Search all wordsOrganism:(Homo AND sapiens ...) Search any wordsOrganism:(Homo OR sapiens ...) Regexp queryOrganism:/regexp/ Search exactly matchOrganism:"Homo sapiens"
Lineage	Search all wordsLineage:(Eukaryota AND Metazoa ...) Search any wordsLineage:(Eukaryota OR Metazoa ...) Regexp queryLineage:/regexp/
Reference Author	Search all wordsReferenceAuthor:(Mishima AND Shizuoka ...) Search any wordsReferenceAuthor:(Mishima OR Shizuoka ...) Regexp queryReferenceAuthor:/regexp/ Search exactly matchReferenceAuthor:"Mishima,H."
Reference Title	Search all wordsReferenceTitle:(expressed AND liver ...) Search any wordsReferenceTitle:(expressed OR liver ...) Regexp queryReferenceTitle:/regexp/ Search exactly matchReferenceTitle:"expressed in human liver"
Reference Journal	Search all wordsReferenceJournal:(30-NOV-2008 AND Hanako ...) Search any wordsReferenceJournal:(30-NOV-2008 OR Hanako ...) Regexp queryReferenceJournal:/regexp/ Search exactly matchReferenceJournal:"Hanako Mishima"
Reference PubmedID	Search all wordsReferencePubmedID:(1111111 AND 1111112 ...) Search any wordsReferencePubmedID:(1111111 OR 1111112 ...) Regexp queryReferencePubmedID:/regexp/ Search rangingReferencePubmedID:[1111110 TO 1111119]
Feature	Search all wordsFeature:(GT200015 AND gt11 ...) Search any wordsFeature:(GT200015 OR gt11 ...) Search exactly matchFeature:"gene=\"GAPD\""
Feature Qualifier	Search one feature-qualifierFeatureQualifier:/source \/clone=GT200015/ Search all feature-qualifiersFeatureQualifier:(/source \/clone=GT200015/ AND /CDS \/gene=GAPD/ ...)
All Text	Search with field_name 'AllText'AllText:any_formats

LOCUS	AB000000 450 bp mRNA linear HUM 01-JUN-2009
DEFINITION	Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds.
ACCESSION	AB999999 AB888888 AB777777
VERSION	AB000000.1
KEYWORDS	HTC; HTC_FLI; oligo capping.
SOURCE	Homo sapiens (human)
ORGANISM	Homo sapiens
	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
	Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
	Catarrhini; Hominidae; Homo.
REFERENCE	1 (bases 1 to 450)
AUTHORS	Mishima,H. and Shizuoka,T.
TITLE	Direct Submission
JOURNAL	Submitted (30-NOV-2008) to the DDBJ/EMBL/GenBank databases. Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; Yata 1111, Mishima, Shizuoka 411-8540, Japan
PUBMED	1111111
REFERENCE	2
AUTHORS	Mishima,H., Shizuoka,T. and Fuji,I.
TITLE	Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver
JOURNAL	Unpublished (2009)
COMMENT	Human cDNA sequencing project.
FEATURES		Location/Qualifiers
source		1..450
source		/chromosome="12"
source		/clone="GT200015"
source		/clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)"
source		/db_xref="taxon:9606"
source		/map="12p13"
source		/mol_type="mRNA"
source		/organism="Homo sapiens"
source		/tissue_type="liver"
CDS		86..>450
CDS		/codon_start=1
CDS		/gene="GAPD"
CDS		/product="glyceraldehyde-3-phosphate dehydrogenase"
CDS		/protein_id="BAA12345.1"
CDS		/transl_table=1
CDS		/translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV"
BASE COUNT 102 a 119 c 131 g 98 t
ORIGIN
1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct
61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg
121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc
181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt
241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg
301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac
361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc
421 tcaacttaag ggtggtgcta agaaggtctg
//

Search Result

Facet

List of Entries

1 - entries / Number of founds: 47 FlatFile XML Fasta

	PrimaryAccessionNumber	Definition	SequenceLength	MolecularType	Organism
	JX472248	Synthetic construct clone HXB2POL_AtoT pol gene, partial sequence.	990	DNA	synthetic construct
	JX472256	Synthetic construct clone HXB2ENV_TtoA env gene, partial sequence.	987	DNA	synthetic construct
	JX472243	Synthetic construct clone HXB2GAG_AtoT gag gene, partial sequence.	990	DNA	synthetic construct
	JX472251	Synthetic construct clone HXB2POL_del1bp pol gene, partial sequence.	989	DNA	synthetic construct
	JX472259	Synthetic construct clone HXB2ENV_ins3bp env gene, partial sequence.	990	DNA	synthetic construct
	JX472247	Synthetic construct clone HXB2GAG_ins3bp gag gene, partial sequence.	993	DNA	synthetic construct
	JX472255	Synthetic construct clone HXB2ENV_TtoC env gene, partial sequence.	987	DNA	synthetic construct
	U03331	HIV-1 clone NEF42 long terminal repeat, complete sequence.	462	DNA	Human immunodeficiency virus 1
	JX472244	Synthetic construct clone HXB2GAG_AtoC gag gene, partial sequence.	990	DNA	synthetic construct
	JX472252	Synthetic construct clone HXB2POL_ins9bp pol gene, partial sequence.	999	DNA	synthetic construct
	JX472249	Synthetic construct clone HXB2POL_AtoC pol gene, partial sequence.	990	DNA	synthetic construct
	JX472257	Synthetic construct clone HXB2ENV_del1bp env gene, partial sequence.	986	DNA	synthetic construct
	JX472242	Synthetic construct clone HXB2GAG_AtoG gag gene, partial sequence.	990	DNA	synthetic construct
	JX472250	Synthetic construct clone HXB2POL_AtoG pol gene, partial sequence.	990	DNA	synthetic construct
	JX472258	Synthetic construct clone HXB2ENV_ins9bp env gene, partial sequence.	996	DNA	synthetic construct
	JX472246	Synthetic construct clone HXB2GAG_ins9bp gag gene, partial sequence.	999	DNA	synthetic construct
	JX472254	Synthetic construct clone HXB2ENV_TtoG env gene, partial sequence.	987	DNA	synthetic construct
	JX472245	Synthetic construct clone HXB2GAG_del1bp gag gene, partial sequence.	989	DNA	synthetic construct
	JX472253	Synthetic construct clone HXB2POL_ins3bp pol gene, partial sequence.	993	DNA	synthetic construct
	AF486270	HIV-1 isolate pt.00.dn40ddihuc from Portugal protease (pol) gene, partial cds.	273	RNA	Human immunodeficiency virus 1
	AF486269	HIV-1 isolate pt.00.dn01ddihuc from Portugal protease (pol) gene, partial cds.	291	RNA	Human immunodeficiency virus 1
	X96498	Human immunodeficiency virus type 1 gag gene.	637	RNA	Human immunodeficiency virus 1
	U16054	Human immunodeficiency virus type 1 clone XSH141R2D envelope glycoprotein (env) mRNA, V1-V5 regions, partial cds.	1051	mRNA	Human immunodeficiency virus 1
	U16057	Human immunodeficiency virus type 1 clone XSH141R5D envelope glycoprotein (env) mRNA, V1-V5 regions, partial cds.	1051	mRNA	Human immunodeficiency virus 1
	U16064	Human immunodeficiency virus type 1 clone XSH144C12R envelope glycoprotein (env) gene, V1-V5 region, partial cds.	1051	RNA	Human immunodeficiency virus 1
	U16056	Human immunodeficiency virus type 1 clone XSH141R4D envelope glycoprotein (env) mRNA, V1-V5 regions, partial cds.	1051	mRNA	Human immunodeficiency virus 1
	U16059	Human immunodeficiency virus type 1 clone XSH141R7D envelope glycoprotein (env) mRNA, V1-V5 regions, partial cds.	1051	mRNA	Human immunodeficiency virus 1
	U16067	Human immunodeficiency virus type 1 clone XSH144C3R envelope glycoprotein (env) gene, V1-V5 region, partial cds.	1051	RNA	Human immunodeficiency virus 1
	U16074	Human immunodeficiency virus type 1 clone XSH144L1D envelope glycoprotein (env) gene, V1-V5 region, partial cds.	1048	DNA	Human immunodeficiency virus 1
	U16058	Human immunodeficiency virus type 1 clone XSH141R6D envelope glycoprotein (env) mRNA, V1-V5 regions, partial cds.	1051	mRNA	Human immunodeficiency virus 1
Now loading

PAGE TOP