ARSA (Search Result) Help

Search Condition

Advanced Search Quick Search

Field

Primary Accession Number

e.g.	Same as Quick Search
`AA000001`	`PrimaryAccessionNumber:AA000001` `pa:AA000001`
`AA00000*`	`pa:AA00000*`
`/AA00000[1-3]/`	`pa:/AA00000[1-3]/`
`AA000001 AA000002`	`pa:(AA000001 OR AA000002)`

Hide examples

Accession Number

e.g.	Same as Quick Search
`AA000001`	`AccessionNumber:AA000001` `an:AA000001`
`AA00000*`	`an:AA00000*`
`/AA00000[1-3]/`	`an:/AA00000[1-3]/`
`AA000001 AA000002`	`an:(AA000001 OR AA000002)`

Hide examples

Sequence Length

e.g.			Same as Quick Search
`400`	to	`500`	`SequenceLength:[400 TO 500]` `sl:[400 TO 500]`
	to	`500`	`sl:[* TO 500]`
`100`	to		`sl:[100 TO *]`
`450`	to	`450`	`sl:450`

Hide examples

Molecular Type

DNA RNA cRNA mRNA rRNA tRNA PRT

Same as Quick Search
`MolecularType:DNA` `mt:DNA`
`mt:(DNA OR RNA)`

Hide examples

Molecular Form

circular linear

Same as Quick Search
`MolecularForm:circular` `mf:circular`
`mf:(circular OR linear)`

Hide examples

Division

Same as Quick Search
`Division:BCT` `dv:BCT`
`dv:(BCT OR CON)`

Hide examples

Date

e.g.			Same as Quick Search
`20130101`	to	`20131231`	`Date:[20130101 TO 20131231]` `dt:[20130101 TO 20131231]`
	to	`20131231`	`dt:[* TO 20131231]`
`20130101`	to		`dt:[20130101 TO *]`
`20130401`	to	`20130401`	`dt:20130401`

Hide examples

Definition

e.g.	Same as Quick Search
`"catalase gene"`	`Definition:"catalase gene"` `df:"catalase gene"`
`"Homo sapiens cDNA, clone:ABC123, 3' end, expressed in brain"`	`df:"Homo sapiens cDNA, clone:ABC123, 3' end, expressed in brain"`
`/Homo sapiens cDNA, clone:[A-Z0-9]+, 3' end, expressed in brain/`	`df:/Homo sapiens cDNA, clone:[A-Z0-9]+, 3' end, expressed in brain/`

Hide examples

Keyword

e.g.	Same as Quick Search
`BARCODE`	`Keyword:BARCODE` `kw:BARCODE`
`HTGS_*`	`kw:HTGS_*`
`\(3'-EST\)`	`kw:\(3'-EST\)`
`"(3'-EST)"`	`kw:"(3'-EST)"`
`/[35]\'-EST/`	`kw:/[35]\'-EST/`
`/TPA\:(experimental\|reassembly)/`	`kw:/TPA\:(experimental\|reassembly)/`

Hide examples

Organism

e.g.	Same as Quick Search
`"Homo sapiens"`	`Organism:"Homo sapiens"` `og:"Homo sapiens"`
`"Mus musculus" "Rattus norvegicus"`	`og:("Mus musculus" OR "Rattus norvegicus")`

Hide examples

Lineage

e.g.	Same as Quick Search
`Vertebrata`	`Lineage:Vertebrata` `ln:Vertebrata`
`Vertebrata Insecta`	`ln:(Vertebrata OR Insecta)`

Hide examples

Reference Authors

e.g.	Same as Quick Search
`Mishima`	`ReferenceAuthor:Mishima` `ra:Mishima`
`Mishima Shizuoka`	`ra:(Mishima OR Shizuoka)`

Hide examples

Reference Title

e.g.	Same as Quick Search
`"human liver"`	`ReferenceTitle:"human liver"` `rt:"human liver"`
`"stomach cancer" "gastric cancer"`	`rt:("stomach cancer" OR "gastric cancer")`

Hide examples

Reference Journal

e.g.	Same as Quick Search
`"National Institute of Genetics"`	`ReferenceJournal:"National Institute of Genetics"` `rj:"National Institute of Genetics"`

Hide examples

Reference PubmedID

e.g.	Same as Quick Search
`1234567`	`ReferencePubmedID:1234567` `rp:1111111`
`[2222222 TO 3333333]`	`rp:[2222222 TO 3333333]`
`[* TO 3333333]`	`rp:[* TO 3333333]`
`[2222222 TO *]`	`rp:[2222222 TO *]`
`4444444`	`rp:4444444`
`5555555 6666666`	`rp:(5555555 OR 6666666)`

Hide examples

Comment

e.g.	Same as Quick Search
`"Human cDNA sequencing project"`	`Comment:"Human cDNA sequencing project"` `cm:"Human cDNA sequencing project"`

Hide examples

Features

Feature Key	Qualifier Name	Qualifier Value
more features

e.g.			Same as Quick Search
Feature Key	Qualifier Name	Qualifier Value	Same as Quick Search
		`taxon:9606`	`Feature:"taxon:9606"` `fe:"taxon:9606"`
`source`	`chromosome`	`12`	`FeatureQualifier:("source /chromosome=12" AND "source /clone_lib=lambda gt11 human liver cDNA (GeneTech. No.20)" AND "source /db_xref=taxon:9606" AND "CDS /codon_start=1" AND "CDS /translation=")`
`source`	`clone_lib`	`lambda gt11 human liver cDNA (GeneTech. No.20)`
`source`	`db_xref`	`taxon:9606`
`CDS`	`codon_start`	`1`
`CDS`	`translation`
`source`	`chromosome`	`12`	`fq:("source /chromosome=12" AND "source /clone_lib=lambda gt11 human liver cDNA (GeneTech. No.20)" AND "source /db_xref=taxon:9606" AND "CDS /codon_start=1" AND "CDS /translation=")`
`source`	`clone_lib`	`lambda gt11 human liver cDNA (GeneTech. No.20)`
`source`	`db_xref`	`taxon:9606`
`CDS`	`codon_start`	`1`
`CDS`	`translation`

Hide examples

All Text

e.g.	Same as Quick Search
`human`	`AllText:human` `at:human`

Hide examples

Combine Searches with

Search Condition

Quick Search Advanced Search

Available Fields

Field	Query Formats
Primary Accession Number	Search all wordsPrimaryAccessionNumber:(AB999999 AND AB999998 ...) Search any wordsPrimaryAccessionNumber:(AB999999 OR AB999999 ...) Regexp queryPrimaryAccessionNumber:/regexp/
Accession Number	Search all wordsAccessionNumber:(AB999999 AND AB888888 ...) Search any wordsAccessionNumber:(AB999999 OR AB888888 ...) Regexp queryAccessionNumber:/regexp/
Division	Search any divisionsDivision:(HUM OR PRI ...)
Sequence Length	Search rangingSequenceLength:[450 TO 500]
Molecular Type	Search any molecular typesMolecularType:(mRNA OR DNA ...)
Molecular Form	Search any molecular formsMolecularForm:(circular OR linear)
Date	Search rangingDate:[20090601 TO 20090701]
Definition	Search all wordsDefinition:(partial AND cds ...) Search any wordsDefinition:(partial OR cds ...) Regexp queryDefinition:/regexp/ Search exactly matchDefinition:"partial cds"
Comment	Search all wordsComment:(sequencing AND project ...) Search any wordsComment:(sequencing OR project ...) Regexp queryComment:/regexp/ Search exactly matchComment:"sequencing project"
Keyword	Search all wordsKeyword:(HTC AND HTC_FLI ...) Search any wordsKeyword:(HTC OR HTC_FLI ...) Regexp queryKeyword:/regexp/ Search exactly matchKeyword:"oligo capping"
Organism	Search all wordsOrganism:(Homo AND sapiens ...) Search any wordsOrganism:(Homo OR sapiens ...) Regexp queryOrganism:/regexp/ Search exactly matchOrganism:"Homo sapiens"
Lineage	Search all wordsLineage:(Eukaryota AND Metazoa ...) Search any wordsLineage:(Eukaryota OR Metazoa ...) Regexp queryLineage:/regexp/
Reference Author	Search all wordsReferenceAuthor:(Mishima AND Shizuoka ...) Search any wordsReferenceAuthor:(Mishima OR Shizuoka ...) Regexp queryReferenceAuthor:/regexp/ Search exactly matchReferenceAuthor:"Mishima,H."
Reference Title	Search all wordsReferenceTitle:(expressed AND liver ...) Search any wordsReferenceTitle:(expressed OR liver ...) Regexp queryReferenceTitle:/regexp/ Search exactly matchReferenceTitle:"expressed in human liver"
Reference Journal	Search all wordsReferenceJournal:(30-NOV-2008 AND Hanako ...) Search any wordsReferenceJournal:(30-NOV-2008 OR Hanako ...) Regexp queryReferenceJournal:/regexp/ Search exactly matchReferenceJournal:"Hanako Mishima"
Reference PubmedID	Search all wordsReferencePubmedID:(1111111 AND 1111112 ...) Search any wordsReferencePubmedID:(1111111 OR 1111112 ...) Regexp queryReferencePubmedID:/regexp/ Search rangingReferencePubmedID:[1111110 TO 1111119]
Feature	Search all wordsFeature:(GT200015 AND gt11 ...) Search any wordsFeature:(GT200015 OR gt11 ...) Search exactly matchFeature:"gene=\"GAPD\""
Feature Qualifier	Search one feature-qualifierFeatureQualifier:/source \/clone=GT200015/ Search all feature-qualifiersFeatureQualifier:(/source \/clone=GT200015/ AND /CDS \/gene=GAPD/ ...)
All Text	Search with field_name 'AllText'AllText:any_formats

LOCUS	AB000000 450 bp mRNA linear HUM 01-JUN-2009
DEFINITION	Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds.
ACCESSION	AB999999 AB888888 AB777777
VERSION	AB000000.1
KEYWORDS	HTC; HTC_FLI; oligo capping.
SOURCE	Homo sapiens (human)
ORGANISM	Homo sapiens
	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
	Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
	Catarrhini; Hominidae; Homo.
REFERENCE	1 (bases 1 to 450)
AUTHORS	Mishima,H. and Shizuoka,T.
TITLE	Direct Submission
JOURNAL	Submitted (30-NOV-2008) to the DDBJ/EMBL/GenBank databases. Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; Yata 1111, Mishima, Shizuoka 411-8540, Japan
PUBMED	1111111
REFERENCE	2
AUTHORS	Mishima,H., Shizuoka,T. and Fuji,I.
TITLE	Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver
JOURNAL	Unpublished (2009)
COMMENT	Human cDNA sequencing project.
FEATURES		Location/Qualifiers
source		1..450
source		/chromosome="12"
source		/clone="GT200015"
source		/clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)"
source		/db_xref="taxon:9606"
source		/map="12p13"
source		/mol_type="mRNA"
source		/organism="Homo sapiens"
source		/tissue_type="liver"
CDS		86..>450
CDS		/codon_start=1
CDS		/gene="GAPD"
CDS		/product="glyceraldehyde-3-phosphate dehydrogenase"
CDS		/protein_id="BAA12345.1"
CDS		/transl_table=1
CDS		/translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV"
BASE COUNT 102 a 119 c 131 g 98 t
ORIGIN
1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct
61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg
121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc
181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt
241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg
301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac
361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc
421 tcaacttaag ggtggtgcta agaaggtctg
//

Search Result

Facet

List of Entries

1 - entries / Number of founds: 7747674 FlatFile XML Fasta

	PrimaryAccessionNumber	Definition	SequenceLength	MolecularType	Organism
	M26641	Human transferrin.	183	mRNA	Homo sapiens
	X16162	Human DNA homologous to human telomeric sequence.	973	DNA	Homo sapiens
	M73258	Human cellular DNA/Human papillomavirus proviral DNA.	6042	DNA	Human papillomavirus
	L31658	Human STS UT173.	404	DNA	Homo sapiens
	L32607	Human homeobox-like gene.	4283	DNA	Homo sapiens
	L49171	Human OCP2 gene fragment.	125	DNA	Homo sapiens
	L02062	Human repeat polymorphism gene.	309	DNA	Homo sapiens
	L13116	Human tandem repeat polymorphism.	231	DNA	Homo sapiens
	L13124	Human tandem repeat polymorphism.	274	DNA	Homo sapiens
	L22525	Human matrilysin promoter.	1205	DNA	Homo sapiens
	L27603	Human nuclear pseudogene.	100	DNA	Homo sapiens
	FM210545	Human Adenovirus 29 fibershaft.	444	DNA	Human adenovirus 29
	FM210553	Human Adenovirus 44 fibershaft.	444	DNA	Human adenovirus 44
	K03513	Human calcitonin mRNA, partial.	109	mRNA	Homo sapiens
	U38615	Human mariner transposon humar1g1.	1591	DNA	Homo sapiens
	U43374	Human normal keratinocyte mRNA.	1267	mRNA	Homo sapiens
	U18669	Human Stat1 gene, exon.	197	DNA	Homo sapiens
	U91729	Human 90K promoter region.	3271	DNA	Homo sapiens
	U53012	Human microsatellite marker sAVA5.	253	DNA	Homo sapiens
	U67811	Human primary Alu transcript.	340	RNA	Homo sapiens
	U67819	Human primary Alu transcript.	378	RNA	Homo sapiens
	U67827	Human primary Alu transcript.	317	RNA	Homo sapiens
	X03168	Human mRNA for S-protein.	1582	mRNA	Homo sapiens
	X03541	Human mRNA of trk oncogene.	2301	mRNA	Homo sapiens
	X05196	Human aldolase C gene.	6694	DNA	Homo sapiens
	X13224	Human mRNA for perforin (P1).	1668	mRNA	Homo sapiens
	U03672	Human clone H3 mRNA.	222	mRNA	Homo sapiens
	V00509	Human gene for preproenkephalin.	1014	DNA	Homo sapiens
	V00589	Human 5S ribosomal RNA.	121	mRNA	Homo sapiens
	X15218	Human ski oncogene mRNA.	3511	mRNA	Homo sapiens
Now loading

PAGE TOP

ARSA (Search Result) Help

Search Condition

Advanced Search Quick Search

Search Settings

Search Condition

Quick Search Advanced Search

Available Fields

Search Result

Facet

List of Entries