ARSA (Search Result) ヘルプ

Search Condition

Quick Search

Available Fields

Field	Query Formats
Primary Accession Number	Search all wordsPrimaryAccessionNumber:(AB999999 AND AB999998 ...) Search any wordsPrimaryAccessionNumber:(AB999999 OR AB999999 ...) Regexp queryPrimaryAccessionNumber:/regexp/
Accession Number	Search all wordsAccessionNumber:(AB999999 AND AB888888 ...) Search any wordsAccessionNumber:(AB999999 OR AB888888 ...) Regexp queryAccessionNumber:/regexp/
Division	Search any divisionsDivision:(HUM OR PRI ...)
Sequence Length	Search rangingSequenceLength:[450 TO 500]
Molecular Type	Search any molecular typesMolecularType:(mRNA OR DNA ...)
Molecular Form	Search any molecular formsMolecularForm:(circular OR linear)
Date	Search rangingDate:[20090601 TO 20090701]
Definition	Search all wordsDefinition:(partial AND cds ...) Search any wordsDefinition:(partial OR cds ...) Regexp queryDefinition:/regexp/ Search exactly matchDefinition:"partial cds"
Comment	Search all wordsComment:(sequencing AND project ...) Search any wordsComment:(sequencing OR project ...) Regexp queryComment:/regexp/ Search exactly matchComment:"sequencing project"
Keyword	Search all wordsKeyword:(HTC AND HTC_FLI ...) Search any wordsKeyword:(HTC OR HTC_FLI ...) Regexp queryKeyword:/regexp/ Search exactly matchKeyword:"oligo capping"
Organism	Search all wordsOrganism:(Homo AND sapiens ...) Search any wordsOrganism:(Homo OR sapiens ...) Regexp queryOrganism:/regexp/ Search exactly matchOrganism:"Homo sapiens"
Lineage	Search all wordsLineage:(Eukaryota AND Metazoa ...) Search any wordsLineage:(Eukaryota OR Metazoa ...) Regexp queryLineage:/regexp/
Reference Author	Search all wordsReferenceAuthor:(Mishima AND Shizuoka ...) Search any wordsReferenceAuthor:(Mishima OR Shizuoka ...) Regexp queryReferenceAuthor:/regexp/ Search exactly matchReferenceAuthor:"Mishima,H."
Reference Title	Search all wordsReferenceTitle:(expressed AND liver ...) Search any wordsReferenceTitle:(expressed OR liver ...) Regexp queryReferenceTitle:/regexp/ Search exactly matchReferenceTitle:"expressed in human liver"
Reference Journal	Search all wordsReferenceJournal:(30-NOV-2008 AND Hanako ...) Search any wordsReferenceJournal:(30-NOV-2008 OR Hanako ...) Regexp queryReferenceJournal:/regexp/ Search exactly matchReferenceJournal:"Hanako Mishima"
Reference PubmedID	Search all wordsReferencePubmedID:(1111111 AND 1111112 ...) Search any wordsReferencePubmedID:(1111111 OR 1111112 ...) Regexp queryReferencePubmedID:/regexp/ Search rangingReferencePubmedID:[1111110 TO 1111119]
Feature	Search all wordsFeature:(GT200015 AND gt11 ...) Search any wordsFeature:(GT200015 OR gt11 ...) Search exactly matchFeature:"gene=\"GAPD\""
Feature Qualifier	Search one feature-qualifierFeatureQualifier:/source \/clone=GT200015/ Search all feature-qualifiersFeatureQualifier:(/source \/clone=GT200015/ AND /CDS \/gene=GAPD/ ...)
All Text	Search with field_name 'AllText'AllText:any_formats

LOCUS	AB000000 450 bp mRNA linear HUM 01-JUN-2009
DEFINITION	Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds.
ACCESSION	AB999999 AB888888 AB777777
VERSION	AB000000.1
KEYWORDS	HTC; HTC_FLI; oligo capping.
SOURCE	Homo sapiens (human)
ORGANISM	Homo sapiens
	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
	Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
	Catarrhini; Hominidae; Homo.
REFERENCE	1 (bases 1 to 450)
AUTHORS	Mishima,H. and Shizuoka,T.
TITLE	Direct Submission
JOURNAL	Submitted (30-NOV-2008) Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; Yata 1111, Mishima, Shizuoka 411-8540, Japan
PUBMED	1111111
REFERENCE	2
AUTHORS	Mishima,H., Shizuoka,T. and Fuji,I.
TITLE	Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver
JOURNAL	Unpublished (2009)
COMMENT	Human cDNA sequencing project.
FEATURES		Location/Qualifiers
source		1..450
source		/chromosome="12"
source		/clone="GT200015"
source		/clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)"
source		/db_xref="taxon:9606"
source		/map="12p13"
source		/mol_type="mRNA"
source		/organism="Homo sapiens"
source		/tissue_type="liver"
CDS		86..>450
CDS		/codon_start=1
CDS		/gene="GAPD"
CDS		/product="glyceraldehyde-3-phosphate dehydrogenase"
CDS		/protein_id="BAA12345.1"
CDS		/transl_table=1
CDS		/translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV"
BASE COUNT 102 a 119 c 131 g 98 t
ORIGIN
1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct
61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg
121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc
181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt
241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg
301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac
361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc
421 tcaacttaag ggtggtgcta agaaggtctg
//

Search Result

Facet

List of Entries

1 - entries / Number of founds: 9324376 FlatFile XML Fasta

	PrimaryAccessionNumber	Definition	SequenceLength	MolecularType	Organism
	PX885217	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149572/2025, complete genome.	29790	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885223	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149578/2025, complete genome.	29775	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885229	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149584/2025, complete genome.	29793	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885235	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149590/2025 ORF1ab polyprotein (ORF1ab), ORF1a polyprotein (ORF1ab), surface glycoprotein (S), ORF3a protein (ORF3a), envelope protein (E), membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), ORF7b (ORF7b), ORF8 protein (ORF8), nucleocapsid phosphoprotein (N), and ORF10 protein (ORF10) genes, complete cds.	29793	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885241	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149596/2025, complete genome.	29789	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885247	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149602/2025, complete genome.	29794	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885253	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149608/2025, complete genome.	29788	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885259	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149614/2025, complete genome.	29772	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885265	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149620/2025, complete genome.	29794	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885271	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149626/2025, complete genome.	29795	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885277	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149632/2025, complete genome.	29738	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885283	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149638/2025 ORF1ab polyprotein (ORF1ab), ORF1a polyprotein (ORF1ab), surface glycoprotein (S), ORF3a protein (ORF3a), envelope protein (E), membrane glycoprotein (M), and ORF6 protein (ORF6) genes, complete cds; ORF7a gene, complete sequence; and ORF7b (ORF7b), ORF8 protein (ORF8), nucleocapsid phosphoprotein (N), and ORF10 protein (ORF10) genes, complete cds.	29779	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885289	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149644/2025, complete genome.	29793	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885295	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149650/2025, complete genome.	29783	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885301	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149656/2025, complete genome.	29773	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885307	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149662/2025, complete genome.	29778	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885313	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149668/2025 ORF1ab polyprotein (ORF1ab), ORF1a polyprotein (ORF1ab), surface glycoprotein (S), ORF3a protein (ORF3a), envelope protein (E), membrane glycoprotein (M), ORF6 protein (ORF6), and ORF7a protein (ORF7a) genes, complete cds; ORF7b gene, complete sequence; and ORF8 protein (ORF8), nucleocapsid phosphoprotein (N), and ORF10 protein (ORF10) genes, complete cds.	29793	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885319	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149674/2025 ORF1ab polyprotein (ORF1ab) and ORF1a polyprotein (ORF1ab) genes, complete cds; surface glycoprotein (S) and ORF3a protein (ORF3a) genes, partial cds; and envelope protein (E), membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), ORF7b (ORF7b), ORF8 protein (ORF8), nucleocapsid phosphoprotein (N), and ORF10 protein (ORF10) genes, complete cds.	29719	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885325	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149680/2025, complete genome.	29793	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885331	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149686/2025, complete genome.	29783	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885337	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149692/2025, complete genome.	29794	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885343	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149698/2025 ORF1ab polyprotein (ORF1ab) and ORF1a polyprotein (ORF1ab) genes, complete cds; surface glycoprotein (S) and ORF3a protein (ORF3a) genes, partial cds; and envelope protein (E), membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), ORF7b (ORF7b), ORF8 protein (ORF8), nucleocapsid phosphoprotein (N), and ORF10 protein (ORF10) genes, complete cds.	29787	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885349	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149704/2025, complete genome.	29790	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885355	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149710/2025 ORF1ab polyprotein (ORF1ab), ORF1a polyprotein (ORF1ab), surface glycoprotein (S), ORF3a protein (ORF3a), envelope protein (E), membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), and ORF7b (ORF7b) genes, complete cds; ORF8 gene, complete sequence; and nucleocapsid phosphoprotein (N) and ORF10 protein (ORF10) genes, complete cds.	29788	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885361	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149716/2025, complete genome.	29793	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885367	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149722/2025, complete genome.	29789	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885373	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149728/2025, complete genome.	29783	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885379	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149734/2025 ORF1ab polyprotein (ORF1ab) and ORF1a polyprotein (ORF1ab) genes, complete cds; surface glycoprotein (S) and ORF3a protein (ORF3a) genes, partial cds; and envelope protein (E), membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), ORF7b (ORF7b), ORF8 protein (ORF8), nucleocapsid phosphoprotein (N), and ORF10 protein (ORF10) genes, complete cds.	29716	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885385	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149740/2025, complete genome.	29719	RNA	Severe acute respiratory syndrome coronavirus 2
	PX885391	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/CA-CDPH-500149747/2025, complete genome.	29790	RNA	Severe acute respiratory syndrome coronavirus 2
Now loading

ページの先頭へ戻る