DNA Data Bank of Japan DNA Database Release 27, Oct. 1996, including 936,697 entries, 608,103,057 bases This database may be copied and redistributed without permission on the condition that all the statements in this release note are reproduced in each copy. The present release contains the newest data prepared by the DNA Data Bank of Japan (DDBJ), GenBank, and European Molecular Biology Laboratory/European Bioinformatics Institute (EMBL/EBI) as of Oct.6, 1996. This unified database was made possible thanks to the international collaboration among the three data banks. All the entries have accordingly been annotated with the feature keys common to them. All the entries designated by the accession numbers with the prefixes "C" and "D" have been collected and processed by DDBJ, and the rest have been prepared by GenBank and EMBL/EBI. The present release includes also entries with the accession numbers in a new form. The new accession number, which was authorized at the International DNA Data Bank Advisors and Collaborators Meetings in 1995, is represented in two letters and six digits combined together like AA123456. Thus please be careful when you use our database by an accession number. There have been a number of genome projects going on worldwide. Among them human genome projects have probably been most productive and yielded a large number of ordinary sequences and huge amounts of ESTs. We now think that we will serve better if we have a separate division for human sequences. For example, in that way one could more easily go over from the DNA databases to the human gene mapping database run by the Genome Data Base, or vice versa. Thus we have the human (HUM) division solely for human sequences and the primate (PRI) division for non-human primate sequences. Note that both the organella (ORG) and EST divisions also contain human sequences. Thus if you are interested in human mitochondrial sequences, you have to go to ORG division instead of HUM. The present release includes duplicated entries over the divisions. This was originally caused by the fact that GenBank no longer has a separate division for organella, and data belonging to this category were allocated to the other divisions according to the "host" species. For example, a human mitochondrial DNA sequence now belongs to the primate division in the GenBank database. We, however, still maintain the organella division in this release. To revive the organella division in the GenBank database and incorporate it in this release was nevertheless quite cumbersome and time- consuming, and did not allow us to get the complete results. Namely, the pertinent divisions other than the organella division still include the data from organella. Thus please be careful when you want to retrieve and get results only for nuclear sequences. We apologize for that, and are trying to resolve the problem by working together with the US and European data banks. This release also includes independent categories for patent data. The patent data are those which the Japanese Patent Office (JPO), United States Patent and Trademark Office (USPTO), and the European Patent Office (EPO) collected and processed. The accession numbers of the patent data collected by the Japanese Patent Office start with the prefix "E", those collected and supplied by USPTO and GenBank respectively start with "I", and those collected and supplied by EPO and EMBL/EBI respectively start with "A". The entries with the prefixes "I" and "A" were allotted together to one division, and those with "E" were allocated to a file (japio.dat). Note also that unauthorized use of the patent data may cause legal issues for which we have no responsibility. The number of ESTs has been increasing at an enormous rate and is expected to be growing even more rapidly in the future. To cope with this situation and handle the data files with least possible time and manner, we split the EST data in three files; ddbjest1.seq containing those with the prefixes of the accession numbers from A to M including C, and AA (a new form), ddbjest2.seq containing those with N to S, and ddbjest3.seq containing those with T to Z. From this release a new division, GSS, was added. GSS stands for Genome Survey Sequence, which is similar in nature to EST, except that GSS is genomic DNA whereas EST is cDNA. The index files are not presented in this release except for ddbjacc.idx, ddbjaut.idx, ddbjgen.idx, ddbjjou.idx, and ddbjkey.idx. Instead, we have included a program by which to make the index files not presented in this release. For the use of the program, see the files, seq2indexes.doc, seq2indexes.c, and seq2indexes.h in this release. The present release contains amino acid sequences that were translated from the corresponding nucleotide sequences in our database. In the translation we paid much attention to the fact that some species or organella have a codon different from the universal one, and used the proper codon table. However, if you find an incorrect codon in a translated sequence, please let us know. This release was published by the following DDBJ staff. General administration T. Gojobori, A. Watanabe, Y. Ueda, N. Shirakabe, K. Okuda, M. Ogawa, C. Watanabe, R. Terauchi Database construction Y. Tateno, K. Fukami-Kobayashi, N. Yasuda, Y. Sato, H. Tsutsui, M. Hirashima, A. Hasegawa, A. Suzuki, Y. Yamamoto, M. Sugizaki, A. Kawabuchi, C. Hamamatsu, M. Iwase, R. Suzuki, R. Uchida, Y. Shidahara, M. Gojobori, M. Shimoyama, K. Nomura, M. Imma Database software development and management H. Sugawara, S. Miyazaki, T. Tamura, K. Goto, S. Misu, R. Tanabe, T. Okayama, Y. Kawanishi, J. Ishi-i, T. Koike, H. Yamamoto, H. Sugiyama, D. Kawasaki, T. Futatsuki System management K. Nishikawa, M. Ota, S. Miyazawa, T. Ito, I. Mochizuki, H. Muto, T. Mizunuma, M. Kikuchi, K. Hatakeyama, A. Murakami Editorial and public relations N. Saitou, T. Imanishi, M. Horie, Y. Daito, Y. Hattori, S. Nagira, T. Kawamoto, K. Ichikawa, E. Sugimura, Y. Noguchi DNA Data Bank of Japan Center for Information Biology National Institute of Genetics Mishima 411, Japan Phone: +81 559 81 6853 FAX: +81 559 81 6849 E-mail: ddbj@ddbj.nig.ac.jp (for general inquiry) ddbjsub@ddbj.nig.ac.jp (for data submission) ddbjupdt@ddbj.nig.ac.jp (for updates and notification of publication) WWW: http://www.ddbj.nig.ac.jp (for DDBJ WWW server) http://sakura.ddbj.nig.ac.jp (for DDBJ sequence data submission system SAKURA) Acknowledgement: We are grateful to NCBI and EMBL/EBI for permitting us to include their data in the present release. We also thank the Japanese Patent Office and Japan Patent Information Organization for kindly allowing us to distribute the patent data they collected and processed. DDBJ Database Release History Release Date Entries Bases Comments -------------------------------------------------------------------- 27 10/96 936,697 608,103,057 GenBank and EMBL included 26 07/96 835,552 551,932,448 GenBank and EMBL included 25 04/96 744,490 499,300,364 GenBank and EMBL included 24 01/96 637,508 431,771,652 GenBank and EMBL included 23 10/95 569,757 390,694,350 GenBank and EMBL included 22 07/95 437,588 322,982,425 GenBank and EMBL included 21 04/95 274,596 250,875,023 GenBank and EMBL included 20 01/95 239,689 231,299,557 GenBank and EMBL included 19 10/94 204,332 205,274,131 GenBank and EMBL included 18 07/94 185,230 192,473,021 GenBank and EMBL included 17 04/94 169,957 179,942,209 GenBank and EMBL included 16 01/94 154,626 165,017,628 GenBank and EMBL included 15 10/93 131,649 147,224,690 GenBank and EMBL included 14 07/93 120,350 138,686,333 GenBank and EMBL included 13 04/93 112,067 129,784,445 GenBank and EMBL included 12 01/93 97,683 120,815,244 GenBank and EMBL included 11 07/92 65,693 84,839,075 GenBank and EMBL included 10 01/92 59,317 77,805,556 GenBank and EMBL included 9 07/91 1,130 2,002,124 DDBJ only 8 01/91 879 1,573,442 DDBJ only 7 07/90 681 1,154,211 DDBJ only 6 01/90 496 841,236 DDBJ only 5 07/89 395 679,378 DDBJ only 4 01/89 302 535,985 DDBJ only 3 07/88 230 345,850 DDBJ only 2 01/88 142 199,392 DDBJ only 1 07/87 66 108,970 DDBJ only -------------------------------------------------------------------- This release covers 18 categories of organisms and others as follows: ------------------------------------------------------------------------------ ddbjbct.*** Category for bacteria ddbjest.*** Category for EST (expressed sequence tag) ddbjhum.*** Category for human ddbjgss.*** Category for GSS (Genome Survey Sequence) ddbjinv.*** Category for invertebrates ddbjmam.*** Category for mammals other than primates and rodents ddbjorg.*** Category for organella ddbjpat.*** Category for patents ddbjphg.*** Category for phages ddbjpln.*** Category for plants ddbjpri.*** Category for primates other than human ddbjrna.*** Category for RNAs ddbjrod.*** Category for rodents ddbjsts.*** Category for STS (sequence tagged site) ddbjsyn.*** Category for synthetic DNAs ddbjuna.*** Category for unannotated sequences ddbjvrl.*** Category for viruses ddbjvrt.*** Category for vertebrates other than mammals ------------------------------------------------------------------------------ Each category then has the following nine files. Note that all the files except for ddbj***.seq and ddbj***.sdr may include more than 80 characters in one line. If this is the case, the line is folded at every 81th column in the file on the distribution tape with the fixed record size of 80 bytes. ------------------------------------------------------------------------------ ddbj***.seq List of an entry in DDBJ format, see Table 1. ddbj***.acc List of the accession numbers, see Table 2 . ddbj***.aut List of the authors, see Table 3. ddbj***.dir List of the short directory in DDBJ style, see Table 4. ddbj***.idx List of indices, see Table 5. ddbj***.jou List of the journals, see Table 6. ddbj***.key List of the key words, see Table 7. ddbj***.org List of the species names, see Table 8. ddbj***.sdr List of the short directory in GenBank style, see Table 9. ------------------------------------------------------------------------------ Table 1. Part of the contents in the file 'ddbjbct.seq'. This shows all pieces of information on one entry in DDBJ format. ------------------------------------------------------------------------------ LOCUS ABCAARAA 1624 bp DNA BCT 15-SEP-1990 DEFINITION A.aceti acetic acid resistance protein (aarA) gene, complete cds. ACCESSION M34830 KEYWORDS acetic acid resistance protein. SOURCE A.aceti (strain 10-8) DNA, clone pAR1611. ORGANISM Acetobacter aceti Eubacteria; Proteobacteria; alpha subdivision; Acetobacteraceae; Acetobacter. REFERENCE 1 (bases 1 to 1624) AUTHORS Fukaya,M., Takemura,H., Okumura,H., Kawamura,Y., Horinouchi,S. and Beppu,T. TITLE Cloning of genes responsible for acetic acid resistance in acetobacter aceti JOURNAL J. Bacteriol. 172, 2096-2104 (1990) MEDLINE 90202732 FEATURES Location/Qualifiers source 1..1624 /organism="Acetobacter aceti" RBS 171..176 /note="ribosomal binding site (put.); putative" CDS 185..1495 /note="acetic acid resistance protein (aarA)" /codon_start=1 /transl_table=11 /db_xref="PID:g141730" /translation="MSASQKEGKLSTATISVDGKSAEMPVLSGTLGPDVIDIRKLPAQ LGVFTFDPGYGETAACNSKITFIDGDKGVLLHRGYPIAQLDENASYEEVIYLLLNGEL PNKVQYDTFTNTLTNHTLLHEQIRNFFNGFRRDAHPMAILCGTVGALSAFYPDANDIA IPANRDLAAMRLIAKIPTIAAWAYKYTQGEAFIYPRNDLNYAENFLSMMFARMSEPYK VNPVLARAMNRILILHADHEQNASTSTVRLAGSTGANPFACIAAGIAALWGPAHGGAN EAVLKMLARIGKKENIPAFIAQVKDKNSGVKLMGFGHRVYKNFDPRAKIMQQTCHEVL TELGIKDDPLLDLAVELEKIALSDDYFVQRKLYPNVDFYSGIILKAMGIPTSMFTVLF AVARTTGWVSQWKEMIEEPGQRISRPRQLYIGAPQRDYVPLAKR" misc_signal 1508..1545 /note="transcription termination signal" BASE COUNT 400 a 446 c 404 g 374 t ORIGIN 1 gcatgcattt gcacacattc gcgcgaccct aagcccaaaa aactgtggtt ttccaagcat 61 actcctttcc gataacgctt cgtttatcgc tggcaacctt ccggtttcct tttgaatgag 121 tgacaaagtg tgacgagcag gccgcagcag cgaccgtggc ccaaccatgc agaaggaaac 181 actaatgagc gcgtcgcaga aagaaggtaa gctatctacc gctaccattt cggttgatgg 241 aaaatccgcc gaaatgcctg tgctttcagg cactctggga ccggatgtta tcgacatccg 301 caaacttccg gcgcaactgg gcgttttcac gtttgaccca ggttacgggg aaacagcggc 361 ctgcaacagc aaaatcacct ttattgatgg tgataaaggc gttctgctgc accgtggtta 421 ccctattgcg cagctggacg aaaatgcttc ctacgaagaa gttatttatc tgcttttgaa 481 tggcgaactg cccaacaagg tgcagtacga caccttcacc aacaccctta caaaccatac 541 gctgctgcac gagcagatcc gtaacttctt taacggcttc cggcgtgatg cccacccaat 601 ggccattctg tgtggtacgg ttggggcttt gtctgccttc tacccagatg ccaacgatat 661 tgccattccc gccaatcggg atctggccgc catgcggctg attgccaaaa tcccaaccat 721 tgcggcatgg gcttacaaat acacgcaggg tgaagccttt atctacccgc ggaatgatct 781 gaactacgca gaaaacttcc tgtccatgat gttcgcgcgc atgtccgaac cttacaaggt 841 caaccctgtt ctggcccgcg ccatgaaccg gattctgatt ctgcatgccg atcatgagca 901 gaatgcctct acctccaccg tacgtctggc tggttctaca ggggccaatc cgtttgcctg 961 tattgctgcg ggcattgccg ctctgtgggg acctgcacat ggtggcgcaa acgaagctgt 1021 gctgaaaatg ctggcccgta ttggcaagaa agaaaatatt cctgccttta tcgcacaggt 1081 gaaggacaag aacagcggcg taaagctgat gggctttggc caccgcgttt acaagaactt 1141 cgacccacgt gcgaagatca tgcagcagac ctgccacgaa gtgctgacag aacttggcat 1201 taaggatgat ccgctgctgg atctggcggt tgagctggaa aagattgctc tgagcgatga 1261 ttacttcgtg cagcgcaaac tttacccgaa tgtggatttc tactctggca tcattctcaa 1321 ggccatgggc atccccacca gtatgtttac tgtgctgttt gccgtagccc gcaccaccgg 1381 ctgggtgagc cagtggaagg aaatgattga agaaccgggc cagcgtatca gccgccctcg 1441 ccagctttat attggcgcac cgcagcgtga ctatgtgccg cttgccaaac gctaaaacag 1501 actaacccaa aaagccgact tcccgtaagg aaagtcggct ttttgtttgc acgctgtttc 1561 caaaaaaata gggcggcaga gcgaataaac gctacctagc cttcaggcat aaaaaaacgc 1621 atgc // ------------------------------------------------------------------------------ Table 2. Part of the contents in the file 'ddbjbct.acc'. The first column refers to the secondary accession number, second column to the locus name, and third to the primary accession number. The primary number may be the same as the secondary number. They are arranged in the ascending order of the secondary accession numbers. ------------------------------------------------------------------------------ D00001 -> ECOPBPAA X04516 D00002 -> ECOPYRH X04469 D00006 -> PNS981TET D00006 D00020 -> COLE2LYS D00020 D00021 -> COLE31YS D00021 D00038 -> BRLAM330 D00038 D00066 -> BAC139AC D00066 D00067 -> ECONANA M20207 D00069 -> ECOUVRD2 D00069 D00087 -> BACXYNAA D00087 ------------------------------------------------------------------------------ Table 3. Part of the contents in the file 'ddbjbct.aut'. For each author name given on the left to the arrow, the corresponding locus name and primary accession number are respectively listed on the right. They are arranged in the alphabetical order of the author names. ------------------------------------------------------------------------------ Aan,F. -> STYCRR X05210 Aan,F. -> STYENZI M76176 Aaronson,W. -> ECOKPSD M64977 Aaronson,W. -> ECONEUA J05023 Abad-Lapuebla,M.A. -> VIBTDHI D90238 Abdel-Mawgood,A.L. -> CYAPSBHA X16394 Abdel-Meguid,S.S. -> TRNGDRECM J01843 Abdelal,A. -> STYCARA M36540 Abdelal,A. -> STYCARAB X13200 Abdelal,A.H. -> PSENOSA M60717 ------------------------------------------------------------------------------ Table 4. Part of the short directory in DDBJ style in the file 'ddbjbct.dir'. For each locus name given in the first column, the corresponding primary accession number, molecular type, number of nucleotide pairs, and description for the locus are respectively listed. They are arranged in the alphabetical order of the locus names. ------------------------------------------------------------------------------ ABCAARAA M34830 ds-DNA 1624 A.aceti acetic acid resistance protein (aarA) gene, complete cds. ABCADHCC D00635 ds-DNA 4230 A. polyoxogenes alcohol dehydrogenase (EC 1.1.99.8) and cytochrome c genes. ABCALDH D00521 ds-DNA 2683 A.polyoxogenes membrane-bound aldehyde dehydrogenase gene, complete cds and flanks. ABCBCSAA M37202 ds-DNA 9540 A.xylinum bcs B, bcs C and bcs D genes, complete cds and bcs A gene, partial cds. ABCCELA M76548 ds-DNA 1165 Acetobacter xylinum UDP pyrophosphorylase (celA) gene, complete cds. ABCCELSYN X54676 ds-DNA 5363 A. xylinum gene for cellulose biosynthesis ABCIS1380 D10043 ds-DNA 1665 A.pasteurianus insertion sequence IS1380. ACAADH1 D90004 ds-DNA 2467 Acetobacter aceti(K6033) alcohol dehydrogenase subunit gene(adh1). ACCAAC2 M62833 ds-DNA 1123 Acinetobacter baumannii aminoglycoside acetyltr ansferase (aac2) gene, complete cds. ACCACEAA M62822 ds-DNA 1874 A.baumannii chloramphenicol acetyltransferase (cat) gene, complete cds. ------------------------------------------------------------------------------ Table 5. Part of the contents in the file 'ddbjbct.idx'. The first column refers to the locus name, second column to the starting site of the locus in byte, and third to its ending site in byte. They are arranged in the alphabetical order of the locus names. ------------------------------------------------------------------------------ %***************************** #ABCAARAA 0 3211 #ABCADHCC 3212 10608 #ABCALDH 10609 15864 #ABCBCSAA 15865 29583 #ABCCELA 29584 32289 #ABCCELSYN 32290 40960 #ABCIS1380 40961 44711 #ACAADH1 44712 49357 #ACCAAC2 49358 52395 ------------------------------------------------------------------------------ Table 6. Part of the contents in the file 'ddbjbct.jou'. This gives information on the journal in which sequence data were published. ------------------------------------------------------------------------------ (in) Chaloupka,J. and Krumphanzl,V. (Eds.); Extracellular Enzymes of Microorganisms: 129-137, Plenum Press, New York (1987) -> BACAMYABS M57457 (in) Ganesan,A.T., Chang,S. and Hoch,J.A. (Eds.); Molecular Cloning and Gene Regulation in Bacilli: 3-10, Academic Press, New York (1982) -> BACRG16S M55011 (in) Ganesan,A.T., Chang,S. and Hoch,J.A. (Eds.); Molecular Cloning and Gene Regulation in Bacilli: 3-10, Academic Press, New York (1982) -> BACRG16SA M55006 (in) Ganesan,A.T., Chang,S. and Hoch,J.A. (Eds.); Molecular Cloning and Gene Regulation in Bacilli: 3-10, Academic Press, New York (1982) -> BACRG16SB M55008 (in) Hoch,J.A. and Setlow,P. (Eds.); Molecular Biology of Microbial Differentiation: 85-94, American Society for Microbiology, Washington, DC (1985) -> BACSPOII M57606 (in) Holmgren,A. (Ed.); Thioredoxin and Glutaredoxin Systems: Structure and Function: 11-19, Unknown name, Unknown city (1986) -> ECOTRXA1 M54881 (in) Kjeldgaard,N.C. and Maaloe,O. (Eds.); Control of ribosome synthesis: 138-143, Academic Press, New York (1976) -> ECOLAC J01636 (in) Losick,R. and Chamberlin,M. (Eds.); RNA polymerase: 455-472, Cold Spring Harbor Laboratory, Cold Spring Harbor, NY (1976) -> ECOTGY1 K01197 (in) Sikes,C.S. and Wheeler,A.P. (Eds.); Surface reactive peptides and polymers. Discovery and commercialization.: 186-200, American Chemical Society, Washington, D.C. (1991) -> ECOTGP J01714 (in) Sund,H. and Blauer,G. (Eds.); Protein-Ligand Interactions: 193-207, Walter de Gruyter, New York (1975) -> ECOLAC J01636 (in) Wu,R. and Grossman,L. (Eds.); Methods in Enzymology, Recombinant DNA, part E: In press, Academic Press, New York, N.Y. (1986) -> PLMCG M11320 Acta Microbiol. Pol. 35, 175-190 (1986) -> ECOTGG1 M54893 Actinomycetologica 5, 14-17 (1991) -> STMARGG D00799 Adv. Biophys. 21, 115-133 (1986) -> R10REP M26840 Adv. Biophys. 21, 175-192 (1986) -> ECONUSAA M26839 Adv. Enzyme Regul. 21, 225-237 (1983) -> ECOPURFA M26893 Adv. Exp. Med. Biol. 195, 239-246 (1986) -> ECOAPT M14040 Agric. Biol. Chem. 50, 2155-2158 (1986) -> ECONANA M20207 Agric. Biol. Chem. 50, 2771-2778 (1986) -> BRLAM330 D00038 Agric. Biol. Chem. 51, 2019-2022 (1987) -> BACCGT D00129 Agric. Biol. Chem. 51, 2641-2648 (1987) -> STRSAGP D00219 Agric. Biol. Chem. 51, 2807-2809 (1987) -> BACPGECR M35503 Agric. Biol. Chem. 51, 3133-3135 (1987) -> BACXYLAP D00312 Agric. Biol. Chem. 51, 455-463 (1987) -> BACHDCRY D00117 Agric. Biol. Chem. 51, 953-955 (1987) -> BACXYNAA D00087 Agric. Biol. Chem. 52, 1565-1573 (1988) -> BACIP135 D00348 Agric. Biol. Chem. 52, 1785-1789 (1988) -> BACTMR D00343 Agric. Biol. Chem. 52, 2243-2246 (1988) -> PSEGI D00342 Agric. Biol. Chem. 52, 399-406 (1988) -> BACAMYEB M35517 Agric. Biol. Chem. 52, 479-487 (1988) -> ECAPALI D00217 ------------------------------------------------------------------------------ Table 7. Part of the contents in the file 'ddbjbct.key'. For the locus and accession number respectively given on the right to the arrow, the corresponding key words are listed on the left. ------------------------------------------------------------------------------ A.aceti acetic acid resistance protein (aarA) gene, complete cds. -> ABCAARAA M34830 acetic acid resistance protein. -> ABCAARAA M34830 Cloning of genes responsible for acetic acid resistance in acetobacter aceti -> ABCAARAA M34830 A. polyoxogenes alcohol dehydrogenase (EC 1.1.99.8) and cytochrome c genes. -> ABCADHCC D00635 alcohol dehydrogenase; cytochrome c. -> ABCADHCC D00635 Cloning and sequencing of the gene cluster encoding two subunits of membrane- bound alcohol dehydrogenase from Acetobacter polyoxogenes -> ABCADHCC D00635 These data kindly submitted in computer readable form by: Toshimi Tamaki Nakano Central Biochemical Institute 2-6 Nakamura-cho Handa-shi, Aichi-ken 475 Japan Phone: 0569-21-3331 Fax: 0569-23-8486 -> ABCADHCC D00635 A.polyoxogenes membrane-bound aldehyde dehydrogenase gene, complete cds and flanks. -> ABCALDH D00521 aldehyde dehydrogenase gene; ethanol oxidation; membrane-bound enzyme. -> ABCALDH D00521 Nucleotide sequence of the membrane-bound aldehyde dehydrogenase gene from Acetobacter polyoxogenes -> ABCALDH D00521 ------------------------------------------------------------------------------ Table 8. Part of the contents in the file 'ddbjbct.org'. For the locus and accession number respectively given on the right to the arrow, the corresponding taxonomic names are listed on the left. They are arranged in the alphabetical order of the species names. ------------------------------------------------------------------------------ A. nidulans 6301 DNA. Anacystis nidulans Prokaryota; Bacteria; Gracilicutes; Oxyphotobacteria; Cyanobacteria. -> ANIRUBPS X00019 A. nidulans DNA, clone pAN4. Anacystis nidulans Prokaryota; Bacteria; Gracilicutes; Oxyphotobacteria; Cyanobacteria. -> ANIRGGX X00343 A. nidulans DNA. Anacystis nidulans Prokaryota; Bacteria; Gracilicutes; Oxyphotobacteria; Cyanobacteria. -> ANIRGG X00512 A. polyoxogenes genomic DNA. Acetobacter polyoxogenes Prokaryota; Bacteria; Gracilicutes; Scotobacteria; Aerobic rods and cocci; Azotobacteraceae. - > ABCADHCC D00635 A. quadruplicatum (strain PR-6) DNA, clone pAQPR1. Agmenellum quadruplicatum Prokaryota; Bacteria; Gracilicutes; Oxyphotobacteria; Cyanobacteria. -> AQUPCAB K02660 A. quadruplicatum (strain PR6) DNA. Agmenellum quadruplicatum Prokaryota; Bacteria; Gracilicutes; Oxyphotobacteria; Cyanobacteria. -> AQUCPCAB K02659 A. vinelandii DNA. Azotobacter vinelandii Prokaryota; Bacteria; Gracilicutes; Scotobacteria; Aerobic rods and cocci; Azotobacteraceae. -> AVINIFUSV M17349 A.aceti (strain 10-8) DNA, clone pAR1611. Acetobacter aceti Prokaryota; Bacteria; Gracilicutes; Scotobacteria; Aerobic rods and cocci; Azotobacteraceae. -> ABCAARAA M34830 A.actinomycetemcomitans (strain JP2) DNA, clone lambda-OP8. Actinobacillus actinomycetemcomitans Prokaryota; Bacteria; Gracilicutes; Scotobacteria; Facultatively anaerobic rods; Pasteurellaceae. -> ACNLKTXN M27399 A.anitratum DNA, clone pLJD1. Acinetobacter anitratum Prokaryota; Bacteria; Gracilicutes; Scotobacteria; Neisseriaceae. -> ACCCITSYN M33037 ------------------------------------------------------------------------------ Table 9. Part of the short directory file in GenBank style in the file 'ddbjbct.sdr'. The short directory file contains brief descriptions of all of the sequence entries contained in the GenBank style. ------------------------------------------------------------------------------ ABCAARAA A.aceti acetic acid resistance protein (aarA) gene, complete 1624bp ABCADHCC A. polyoxogenes alcohol dehydrogenase (EC 1.1.99.8) and 4230bp ABCALDH A.polyoxogenes membrane-bound aldehyde dehydrogenase gene, 2683bp ABCBCSABCD A.xylinum bcs A, B, C and D genes, complete cds's. 9540bp ABCCELA Acetobacter xylinum UDP pyrophosphorylase (celA) gene, 1165bp ABCCELSYN A. xylinum gene for cellulose biosynthesis 5363bp ABCIS1380 A.pasteurianus insertion sequence IS1380. 1665bp ACAADH1 Acetobacter aceti(K6033) alcohol dehydrogenase subunit 2467bp ACCAAC2 Acinetobacter baumannii aminoglycoside acetyltransferase 1123bp ACCACEAA A.baumannii chloramphenicol acetyltransferase (cat) gene, 1874bp ACCAPHA6 Acinetobacter baumannii aphA-6 gene. 1170bp ACCBENABCA A.calcoaceticus BenA, BenB, BenC, BenD, and BenE proteins 15922bp ACCCAT Acinetobacter calcoaceticus cat operon. 15922bp ACCCATAM A.calcoaceticus catA and catM genes, encoding catechol 1, 5537bp ACCCHMO Acinetobacter sp. cyclohexanone monooxygenase gene, complete 2128bp ACCCITSYN A.anitratum citrate synthase gene, complete cds. 1895bp ------------------------------------------------------------------------------ In addition to the 9 tables the five following index files are included in this release. These files were prepared irrespective of the 14 categories of taxonomic divisions. Accession number index file Keyword phrase index file Author name index file Journal citation index file Gene name index file A brief description is given for each file in the following. Table 10. Part of the accession number index file in the 'ddbjacc.idx'. The following excerpt from the accession number index file illustrates the format of the index. Note that as mentioned above there are such a case where an accession number for a taxonomic category is the same as that for EST or ORG; for example, PRI D12345 and EST D12345 under the same accession number D12345. ------------------------------------------------------------------------------ M33790 SHFINVEA BCT M33790 M33791 BACORF2 BCT M33791 M33792 FTRCPRBCLC ORG X55829 FTRCPRBCLC PLN X55829 M33793 FTRCPPRBCL ORG X55830 FTRCPPRBCL PLN X55830 M33794 ATPCPARRBC ORG X55831 ATPCPARRBC PLN X55831 ATPCPRBCLB ORG X15925 ATPCPRBCLB PLN X15925 M33796 NRACPNTRBC ORG X55827 NRACPNTRBC PLN X55827 M33797 NRACPRBCL ORG X55828 NRACPRBCL PLN X55828 M33798 ACCPCACGH BCT M33798 M33799 PSETRPEGDC BCT M33799 ------------------------------------------------------------------------------ Table 11. Part of the keyword phrase index file in the 'ddbjkey.idx'. Keyword phrases consist of names for gene products and other characteristics of sequence entries. ------------------------------------------------------------------------------ A CHANNEL DROCHA INV M17155 A COMPONENT SQLCVEA VRL M38183 A LOCUS GORGOGOA3 PRI X54375 GORGOGOA4 PRI X54376 A LOCUS ALLELE GORA0101 PRI X60258 GORA0201 PRI X60259 GORA0401 PRI X60257 GORA0501 PRI X60256 A MULTI-GENE FAMILY RICGLUTE PLN D00584 A PROTEIN MS2AAR PHG M25187 ST1APCS PHG M25396 A SEQUENCE HS5TOA30 VRL D00148 HS5TOA31 VRL D00147 ------------------------------------------------------------------------------ Table 12. Part of the author name index file in 'ddbjaut.idx'. The author name index file lists all of the author names that appear in the citations. ------------------------------------------------------------------------------ ABE,A. HUMMHDRBWE PRI M27509 HUMMHDRBWF PRI M27510 HUMMHDRBWG PRI M27511 YSCGAL11A PLN M22481 ABE,C. S85445 BCT S85445 ABE,E. M23442 UNA M23442 ABE,H. CHKADF VRT M55660 CHKCOF VRT M55659 ABE,K. CHPCLAC PRI D11383 CHPIMRF PRI D11384 CUGCUR09 PLN X64110 CUGCUR37 PLN X64111 HPCCEXPA VRL M55970 HPCCPEP1 VRL D10687 HPCCPEP2 VRL D10688 HPCHABC82 VRL X51587 HPCNS2APA VRL M55972 HPCNS2PA VRL M55971 HPCNS2PB VRL M55973 HPCNS5PA VRL M55974 MUSKE2 ROD M65255 MUSKE2A ROD M65256 MZECYS PLN D10622 RICCPI PLN J03469 RICGLUTE PLN D00584 RICLNOCI PLN J05595 RICOCS PLN M29259 RICORYII PLN X57658 RICOZA PLN D90406 RICOZB PLN D90407 RICOZC PLN D90408 S54524 PLN S54524 S54526 PLN S54526 S54530 PLN S54530 S73960 ROD S73960 ------------------------------------------------------------------------------ Table 13. Part of the journal citation index file in 'ddbjjou.idx'. The journal citation index file lists all of the citations that appear in the references. ------------------------------------------------------------------------------ ACTA BIOCHIM. BIOPHYS. SIN. 23, 246-253 (1992) HUMPLASINS PRI M98056 ACTA BIOCHIM. POL. 24, 301-318 (1977) LUPTRFJ RNA K00345 LUPTRFN RNA K00346 ACTA BIOCHIM. POL. 26, 369-381 (1979) BLYTRNPHE PLN X02683 ACTA BIOCHIM. POL. 29, 143-149 (1982) EMEMTA ORG M32572 EMEMTA PLN M32572 EMEMTB ORG M32573 EMEMTB PLN M32573 EMEMTC ORG M32574 EMEMTC PLN M32574 EMEMTD ORG M32575 EMEMTD PLN M32575 EMEMTE ORG M32576 EMEMTE PLN M32576 ACTA BIOCHIM. POL. 34, 21-27 (1987) LUPNOSP PLN M32571 ------------------------------------------------------------------------------ Table 14. Part of the gene name index file in 'ddbjgen.idx'. This file lists all the gene names that appear in the feature table. ------------------------------------------------------------------------------ AACC8 STMAACC8 BCT M55426 AACC9 MPUAACC9 BCT M55427 AACT HUMA1ACM PRI K01500 HUMA1ACMA PRI X00947 HUMA1ACMB PRI M18035 HUMAACT1 PRI M18906 HUMAACT2 PRI M22533 HUMAACTA PRI J05176 AAD INTINTORF BCT L06418 LMOMO229D BCT X17478 AAD A1 ENTAAC3VI BCT M88012 AAD9 ENEAAD9A BCT M69221 AADA LMOMO229A BCT X17479 S52249 BCT S52249 SYNAADA SYN M60473 TRNTAAB BCT M55547 TRNTN21CAS BCT M86913 ------------------------------------------------------------------------------ The files in this release are arranged in the following order with non- labeled format. Release note ddbjrel.txt 683 records Category for bacteria, 27577 entries, 55751234 bases ddbjbct.seq 2380648 records Category for EST1 (expressed sequence tag), 217596 entries, 74373817 bases ddbjest1.seq 11173905 records Category for EST2 (expressed sequence tag), 178058 entries, 65384957 bases ddbjest2.seq 9403528 records Category for EST3 (expressed sequence tag), 220203 entries, 82971138 bases ddbjest3.seq 11565716 records Category for GSS (Genome Survey Sequence), 7181 entries, 2814295 bases ddbjgss.seq 367175 records Category for human, 56417 entries, 60639040 bases ddbjhum.seq 3306611 records Category for invertebrates, 21527 entries, 68873233 bases ddbjinv.seq 2217842 records Category for mammals, 9607 entries, 9792735 bases ddbjmam.seq 545663 records Category for organella, 15158 entries, 14934572 bases ddbjorg.seq 862127 records Category for patents, 27558 entries, 8996113 bases ddbjpat.seq 705572 records Category for phages, 1213 entries, 1834800 bases ddbjphg.seq 93444 records Category for plants, 33593 entries, 66241456 bases ddbjpln.seq 2687290 records Category for primates, 4779 entries, 2894044 bases ddbjpri.seq 215944 records Category for RNAs, 5100 entries, 2648818 bases ddbjrna.seq 198649 records Category for rodents, 31435 entries, 35781503 bases ddbjrod.seq 1899615 records Category for STS (sequence tagged site), 43706 entries, 14806586 bases ddbjsts.seq 2485443 records Category for synthetic DNAs, 2295 entries, 4833703 bases ddbjsyn.seq 174940 records Category for unannotated sequences, 1627 entries, 1186737 bases ddbjuna.seq 73310 records Category for viruses, 34219 entries, 34939404 bases ddbjvrl.seq 1996876 records Category for vertebrates, 12697 entries, 12843420 bases ddbjvrt.seq 715349 records Accession number index file ddbjacc.idx 948733 records Keyword phrase index file ddbjkey.idx 507287 records Author name index file ddbjaut.idx 4464255 records Journal citation index file ddbjjou.idx 671549 records Gene name index file ddbjgen.idx 124027 records Japan Patent Information Organization sequence file 8979 entries. 6096196 bases japio.dat 386193 records