DNA Data Bank of Japan DNA Database Release 45, Apr. 2001, including 11,434,113 entries, 12,207,092,905 bases This database may be copied and redistributed without permission on the condition that all the statements in this release note are reproduced in each copy. The present release contains the newest data prepared by the DNA Data Bank of Japan (DDBJ), GenBank, and European Molecular Biology Laboratory/European Bioinformatics Institute (EMBL/EBI) as of Mar. 29, 2001. This unified database was made possible thanks to the international collaboration among the three data banks. All the entries have accordingly been annotated with the feature keys common to them. All the entries designated by the accession numbers with the prefixes "C", "D", "E", "AB", "AG", "AK", "AP", "AT", "AU", "AV", "BA" and "BB" have been collected and processed by DDBJ, and the rest have been prepared by GenBank and EMBL/EBI. There have been a number of genome projects going on worldwide. Among them human genome projects have probably been most productive and yielded a large number of ordinary sequences, huge amounts of ESTs and quantities of genome sequences. Thus, we have the human(HUM) division solely for human sequences and the primate (PRI) division for non-human primate sequences. Note that the EST division also contains human sequences. The present release does not have the ORG division. Thus, if you are interested in human mitochondrial sequences, for example, you are now advised to refer to the HUM division. The HUM division in this release is divided into five subdivisions in which 30,000 entries each are allocated except for the last one including the rest. This release also includes an independent division (PAT) for patent data. The patent data are those which the Japanese Patent Office (JPO), United States Patent and Trademark Office (USPTO), and the European Patent Office (EPO) collected and processed. The accession numbers of the patent data collected by the Japanese Patent Office start with the prefix "E", those collected and supplied by USPTO and GenBank respectively start with "I" and "AR", and those collected and supplied by EPO and EMBL/EBI respectively start with "A" and "AX". The entries with the prefixes "I","AR", "A","AX" and "E" were allocated to a file (ddbjpat.seq) in the DDBJ format. Note also that unauthorized use of the patent data may cause legal issues for which we take no responsibility. In the present release, the SOURCE in the flat file was revisited and revised if necessary in accordance with the unified taxonomy database common to the three data banks. The number of ESTs has been increasing at an enormous rate and is expected to be growing even more rapidly in the future. Therefore, EST data were first sorted in terms of accession numbers, and then the result was divided into sets of 100,000 entries each except for the last set. The total number of sets this time is 78. The present release includes the GSS division. GSS stands for the Genome Survey Sequence, which is similar to EST, except that GSS is genomic DNA whereas EST is cDNA. This division is divided into 24 files; each of the first 23 files contains 100,000 entries and the last one does the rest. This release also includes the High Throughput Genome Sequence (HTGS) which comes mainly from genome project teams which deal with a clone as a sequencing unit. HTGS in this release are distributed in 29 files. First 28 files contain 3,000 entries each, and the last one contains the rest. The index files are not presented in this release except for ddbjacc.idx, ddbjgen.idx, ddbjjou.idx, and ddbjkey.idx. Instead, we have included a program by which to make the index files not presented in this release. For the use of the program, see the files, seq2indexes.doc, seq2indexes.c, and seq2indexes.h in this release. The present release contains amino acid sequences that were translated from the corresponding nucleotide sequences in our database. In the translation we paid much attention to the fact that some species or organella have a codon different from the universal one, and used the proper codon table. If you find an incorrect codon in a translated sequence, please let us know. The three data banks include the item VERSION in the flat file, which indicates a version of a submitted nucleotide sequence (see Table 1). It is expressed as AB123456.1, in which the digit(s) after the period is a version number. The reason for adding VERSION is that since a released sequence sometimes revised by the submitter, the accession number alone cannot specify the sequence in question causing the user a trouble. The number is increased by one every time when a revised sequence is made public. Accordingly, the translated protein sequence will be accompanied with a /protein_id which is expressed as BAA12345.1, in which the digit(s) after the period is again a version number. The number is increased by one when the corresponding nucleotide sequence is revised and the protein sequence is changed as a result, and when the revised protein sequence is made public. We terminated the RNA division. The RNA data were redistributed according to the category of the organism. Therefore, you will find a human RNA sequence, for example, in the HUM division. The present release includes a division, CON. The CON division is to show the order of related sequences in a genome, and expressed by join and the accession numbers of the sequences. The contents of the CON division are compiled by the three data banks not by the data submitter. The current number of the entries of this division is 8,722. From the present release, we include a new division, HTC (High Throughput cDNA). The definition of the HTC division is as follows. This division is to include unfinished high throughput cDNA sequences, each of which has 5'UTR and 3'UTR at both ends and part of a coding region. The sequence may also include introns. When the sequence becomes finished later, it moves to the corresponding taxonomic division. The sequence is accompanied with a keyword, HTC (High Throughput cDNA), which is dropped when moved to a taxonomic division. This release was published by the following DDBJ staff. General administration T. Gojobori, M. Ota, Y. Fukuma, Y. Katsube, M. Maruyama, K. Okuda, J. Sugiyama, H. Tsutsui(hold), Y. Ueda, A. Watanabe Database construction Y. Tateno, S. Miyazaki, H. Aono, N. Asakawa, M. Ejima, M. Gojobori, A. Hasegawa, A. Hashizume, M. Hirashima, J. Mashima, N. Mukasa, M. Okaneya, A. Shimada, A. Suzuki, M. Suzuki, H. Tsutsui, T. Umezawa, Y. Yamamoto Database software development and management H. Sugawara, T. Imanishi, S. Miyazaki(hold), M. Fumoto, H. Hashimoto, T. Iizuka(hold), N. Ishizaka, K. Kaneda, T. Kato, Y. Kawanishi, K. Mamiya, S. Misu, T. Mizunuma, T. Okayama, Y. Sugiyama, K. Suzuki, T. Takaki System management K. Nishikawa, K. Ikeo, N. Hoshi, T.Iizuka, I. Mochizuki, M. Nagura, T. Narita, T. Osawa, K. Yoshioka Editorial and public relations N. Saitou, K. Fukami-Kobayashi, Y. Daito, H. Ichikawa, K. Ichikawa, T. Kawamoto, S. Nagira Center for Information Biology and DNA Data Bank of Japan National Institute of Genetics Mishima 411-8540, Japan Phone: +81 559 81 6853 FAX: +81 559 81 6849 E-mail: ddbj@ddbj.nig.ac.jp (for general inquiry) ddbjsub@ddbj.nig.ac.jp (for data submission) ddbjupdt@ddbj.nig.ac.jp (for updates and notification of publication) WWW: http://www.ddbj.nig.ac.jp (for DDBJ WWW server) http://sakura.ddbj.nig.ac.jp (for DDBJ sequence data submission system SAKURA) Acknowledgement: We are grateful to NCBI and EMBL/EBI for a firm friendship and an excellent collaboration with us. We also thank the Japanese Patent Office for a steady cooperation with us. The operation of DDBJ is supported by the Ministry of Education, Culture, Sports, Science and Technology, and we would gratefully note this here. DDBJ Database Release History Release Date Entries Bases Comments ------------------------------------------------------------------------------ 45 04/01 11,434,113 12,207,092,905 HTC division started 44 01/01 10,165,597 11,136,298,841 43 10/00 8,666,551 10,034,532,698 42 07/00 7,554,995 8,880,721,093 41 04/00 5,962,608 6,409,581,885 CON division started 40 01/00 5,388,125 4,762,696,173 RNA division terminated 39 10/99 4,810,773 3,728,000,562 NID and PID discarded 38 07/99 4,294,369 3,098,519,597 37 03/99 3,311,627 2,375,261,951 VERSION, /protein_id started 36 01/99 3,073,166 2,190,425,560 35 10/98 2,759,261 1,957,341,169 34 07/98 2,412,785 1,708,580,623 33 04/98 2,174,769 1,479,303,279 32 01/98 1,956,669 1,300,950,613 31 10/97 1,731,532 1,139,869,464 Adoption of the unified taxonomy database 30 07/97 1,534,115 992,788,339 NID and PID terminated 29 04/97 1,270,194 841,415,232 28 01/97 1,154,120 756,785,219 HTG division started ORG division terminated 27 10/96 936,697 608,103,057 GSS division started 26 07/96 835,552 551,932,448 25 04/96 744,490 499,300,364 /translation started 24 01/96 637,508 431,771,652 23 10/95 569,757 390,694,350 22 07/95 437,588 322,982,425 HUM division started 21 04/95 274,596 250,875,023 20 01/95 239,689 231,299,557 19 10/94 204,332 205,274,131 18 07/94 185,230 192,473,021 17 04/94 169,957 179,942,209 16 01/94 154,626 165,017,628 15 10/93 131,649 147,224,690 14 07/93 120,350 138,686,333 13 04/93 112,067 129,784,445 12 01/93 97,683 120,815,244 EST division started 11 07/92 65,693 84,839,075 10 01/92 59,317 77,805,556 GenBank/EMBL inclusion started 9 07/91 1,130 2,002,124 8 01/91 879 1,573,442 7 07/90 681 1,154,211 6 01/90 496 841,236 5 07/89 395 679,378 4 01/89 302 535,985 3 07/88 230 345,850 2 01/88 142 199,392 1 07/87 66 108,970 Started with DDBJ only ------------------------------------------------------------------------ This release covers 17 categories of organisms and others as follows: ------------------------------------------------------------------------------ ddbjbct.*** Category for bacteria ddbjest.*** Category for EST (expressed sequence tag) ddbjhtg.*** Category for HTG (high throughput genomic sequencing) ddbjhum.*** Category for human ddbjgss.*** Category for GSS (Genome Survey Sequence) ddbjinv.*** Category for invertebrates ddbjmam.*** Category for mammals other than primates and rodents ddbjpat.*** Category for patents ddbjphg.*** Category for phages ddbjpln.*** Category for plants ddbjpri.*** Category for primates other than human ddbjrod.*** Category for rodents ddbjsts.*** Category for STS (sequence tagged site) ddbjsyn.*** Category for synthetic DNAs ddbjuna.*** Category for unannotated sequences ddbjvrl.*** Category for viruses ddbjvrt.*** Category for vertebrates other than mammals ------------------------------------------------------------------------------ Each category then has the following nine files. Note that all the files except for ddbj***.seq are created by the user by use of seq2indexes as mentioned in the release note. ------------------------------------------------------------------------------ ddbj***.seq List of an entry in DDBJ format, see Table 1. ddbj***.acc List of the accession numbers, see Table 2 . ddbj***.aut List of the authors, see Table 3. ddbj***.dir List of the short directory in DDBJ style, see Table 4. ddbj***.idx List of indices, see Table 5. ddbj***.jou List of the journals, see Table 6. ddbj***.key List of the key words, see Table 7. ddbj***.org List of the species names, see Table 8. ddbj***.sdr List of the short directory in DDBJ style, see Table 9. ------------------------------------------------------------------------------ Table 1. Part of the contents in the file 'ddbjbct.seq'. This shows all pieces of information on one entry in DDBJ format. ------------------------------------------------------------------------------ LOCUS D87069 993 bp mRNA BCT 07-FEB-1999 DEFINITION Escherichia coli mRNA for RNA polymerase sigma subunit, truncated form of sigma-38, complete cds. ACCESSION D87069 VERSION D87069.1 KEYWORDS RNA polymerase sigma subunit, truncated form of sigma-38. SOURCE Escherichia coli (strain:W3110) cDNA to mRNA. ORGANISM Escherichia coli Bacteria; Proteobacteria; gamma subdivision; Enterobacteriaceae; Escherichia. REFERENCE 1 (bases 1 to 993) AUTHORS Jishage,M. TITLE Direct Submission JOURNAL Submitted (14-AUG-1996) to the DDBJ/EMBL/GenBank databases. Miki Jishage, National Institute of Genetics, Molecular Genetics; Yata 1111, Mishima, Shizuoka 411, Japan (E-mail:mjishage@lab.nig.ac.jp, Tel:0559-81-6742, Fax:0559-81-6746) REFERENCE 2 (bases 1 to 993) AUTHORS Jishage,M. and Ishihama,A. TITLE Variation in RNA polymerase sigma subunit composition within different stocks of Escherichia coli starin W3110 JOURNAL Unpublished (1996) REFERENCE 3 (sites) AUTHORS Ivanova,A., Renshaw,M., Guntaka,R. and Eisenstark,A. TITLE DNA base sequence variability in katF (putative sigma factor) gene Escherichia coli JOURNAL Nucleic Acids Res. 20, 5479-5480 (1992) REFERENCE 4 (sites) AUTHORS Takayanagi,Y., Tanaka,K. and Takahashi,H. TITLE Structure of the 5' upstream region and the regulation of the rpoS gene of Escherichia coli JOURNAL Mol Gen Genet 243, 525-531 (1994) COMMENT FEATURES Location/Qualifiers source 1..993 /organism="Escherichia coli" /sequenced_mol="cDNA to mRNA" /strain="W3110" CDS 1..810 /note="the gene has four single base changes, resulting in two amino acid substitutions and an amber mutation" /product="RNA polymerase sigma subunit, truncated form of sigma-38" /protein_id="BAA13238.1" /translation="MSQNTLKVHDLNEDAEFDENGVEVFDEKALVEYEPSDNDLAEEE LLSQGATQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLV VKIARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMN QTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNER ITSVDTPLGGDSEKALLDILADEKENGPEDTTQDDDMKQSIVKWLFELNAK" /transl_table=11 mutation 75 /citation=[3] /replace="t" mutation 97 /citation=[3] /replace="t" mutation 99 /citation=[3] /replace="t" mutation 808 /citation=[3] /replace="t" BASE COUNT 254 a 223 c 291 g 225 t 0 others ORIGIN 1 atgagtcaga atacgctgaa agttcatgat ttaaatgaag atgcggaatt tgatgagaac 61 ggagttgagg tttttgacga aaaggcctta gtagaatatg aacccagtga taacgatttg 121 gccgaagagg aactgttatc gcagggagcc acacagcgtg tgttggacgc gactcagctt 181 taccttggtg agattggtta ttcaccactg ttaacggccg aagaagaagt ttattttgcg 241 cgtcgcgcac tgcgtggaga tgtcgcctct cgccgccgga tgatcgagag taacttgcgt 301 ctggtggtaa aaattgcccg ccgttatggc aatcgtggtc tggcgttgct ggaccttatc 361 gaagagggca acctggggct gatccgcgcg gtagagaagt ttgacccgga acgtggtttc 421 cgcttctcaa catacgcaac ctggtggatt cgccagacga ttgaacgggc gattatgaac 481 caaacccgta ctattcgttt gccgattcac atcgtaaagg agctgaacgt ttacctgcga 541 accgcacgtg agttgtccca taagctggac catgaaccaa gtgcggaaga gatcgcagag 601 caactggata agccagttga tgacgtcagc cgtatgcttc gtcttaacga gcgcattacc 661 tcggtagaca ccccgctggg tggtgattcc gaaaaagcgt tgctggacat cctggccgat 721 gaaaaagaga acggtccgga agataccacg caagatgacg atatgaagca gagcatcgtc 781 aaatggctgt tcgagctgaa cgccaaatag cgtgaagtgc tggcacgtcg attcggtttg 841 ctggggtacg aagcggcaac actggaagat gtaggtcgtg aaattggcct cacccgtgaa 901 cgtgttcgcc agattcaggt tgaaggcctg cgccgtttgc gcgaaatcct gcaaacgcag 961 gggctgaata tcgaagcgct gttccgcgag taa // ------------------------------------------------------------------------------ Table 2. Part of the contents in the file 'ddbjbct.acc'. The first column refers to the secondary accession number, second column to the locus name, and third to the primary accession number. The primary number may be the same as the secondary number. They are arranged in the ascending order of the secondary accession numbers. ------------------------------------------------------------------------------ D00001 -> ECOPBPAA X04516 D00002 -> ECOPYRH X04469 D00006 -> PNS981TET D00006 D00020 -> COLE2LYS D00020 D00021 -> COLE31YS D00021 D00038 -> BRLAM330 D00038 D00066 -> BAC139AC D00066 D00067 -> ECONANA M20207 D00069 -> ECOUVRD2 D00069 D00087 -> BACXYNAA D00087 ------------------------------------------------------------------------------ Table 3. Part of the contents in the file 'ddbjbct.aut'. For each author name given on the left to the arrow, the corresponding locus name and primary accession number are respectively listed on the right. They are arranged in the alphabetical order of the author names. ------------------------------------------------------------------------------ Aan,F. -> STYCRR X05210 Aan,F. -> STYENZI M76176 Aaronson,W. -> ECOKPSD M64977 Aaronson,W. -> ECONEUA J05023 Abad-Lapuebla,M.A. -> VIBTDHI D90238 Abdel-Mawgood,A.L. -> CYAPSBHA X16394 Abdel-Meguid,S.S. -> TRNGDRECM J01843 Abdelal,A. -> STYCARA M36540 Abdelal,A. -> STYCARAB X13200 Abdelal,A.H. -> PSENOSA M60717 ------------------------------------------------------------------------------ Table 4. Part of the short directory in DDBJ style in the file 'ddbjbct.dir'. For each locus name given in the first column, the corresponding primary accession number, molecular type, number of nucleotide pairs, and description for the locus are respectively listed. They are arranged in the alphabetical order of the locus names. ------------------------------------------------------------------------------ ABCAARAA M34830 ds-DNA 1624 A.aceti acetic acid resistance protein (aarA) gene, complete cds. ABCADHCC D00635 ds-DNA 4230 A. polyoxogenes alcohol dehydrogenase (EC 1.1.99.8) and cytochrome c genes. ABCALDH D00521 ds-DNA 2683 A.polyoxogenes membrane-bound aldehyde dehydrogenase gene, complete cds and flanks. ABCBCSAA M37202 ds-DNA 9540 A.xylinum bcs B, bcs C and bcs D genes, complete cds and bcs A gene, partial cds. ABCCELA M76548 ds-DNA 1165 Acetobacter xylinum UDP pyrophosphorylase (celA) gene, complete cds. ABCCELSYN X54676 ds-DNA 5363 A. xylinum gene for cellulose biosynthesis ABCIS1380 D10043 ds-DNA 1665 A.pasteurianus insertion sequence IS1380. ACAADH1 D90004 ds-DNA 2467 Acetobacter aceti(K6033) alcohol dehydrogenase subunit gene(adh1). ACCAAC2 M62833 ds-DNA 1123 Acinetobacter baumannii aminoglycoside acetyltr ansferase (aac2) gene, complete cds. ACCACEAA M62822 ds-DNA 1874 A.baumannii chloramphenicol acetyltransferase (cat) gene, complete cds. ------------------------------------------------------------------------------ Table 5. Part of the contents in the file 'ddbjbct.idx'. The first column refers to the locus name, second column to the starting site of the locus in byte, and third to its ending site in byte. They are arranged in the alphabetical order of the locus names. ------------------------------------------------------------------------------ %***************************** #ABCAARAA 0 3211 #ABCADHCC 3212 10608 #ABCALDH 10609 15864 #ABCBCSAA 15865 29583 #ABCCELA 29584 32289 #ABCCELSYN 32290 40960 #ABCIS1380 40961 44711 #ACAADH1 44712 49357 #ACCAAC2 49358 52395 ------------------------------------------------------------------------------ Table 6. Part of the contents in the file 'ddbjbct.jou'. This gives information on the journal in which sequence data were published. ------------------------------------------------------------------------------ (in) Chaloupka,J. and Krumphanzl,V. (Eds.); Extracellular Enzymes of Microorganisms: 129-137, Plenum Press, New York (1987) -> BACAMYABS M57457 (in) Ganesan,A.T., Chang,S. and Hoch,J.A. (Eds.); Molecular Cloning and Gene Regulation in Bacilli: 3-10, Academic Press, New York (1982) -> BACRG16S M55011 (in) Ganesan,A.T., Chang,S. and Hoch,J.A. (Eds.); Molecular Cloning and Gene Regulation in Bacilli: 3-10, Academic Press, New York (1982) -> BACRG16SA M55006 (in) Ganesan,A.T., Chang,S. and Hoch,J.A. (Eds.); Molecular Cloning and Gene Regulation in Bacilli: 3-10, Academic Press, New York (1982) -> BACRG16SB M55008 (in) Hoch,J.A. and Setlow,P. (Eds.); Molecular Biology of Microbial Differentiation: 85-94, American Society for Microbiology, Washington, DC (1985) -> BACSPOII M57606 (in) Holmgren,A. (Ed.); Thioredoxin and Glutaredoxin Systems: Structure and Function: 11-19, Unknown name, Unknown city (1986) -> ECOTRXA1 M54881 (in) Kjeldgaard,N.C. and Maaloe,O. (Eds.); Control of ribosome synthesis: 138-143, Academic Press, New York (1976) -> ECOLAC J01636 (in) Losick,R. and Chamberlin,M. (Eds.); RNA polymerase: 455-472, Cold Spring Harbor Laboratory, Cold Spring Harbor, NY (1976) -> ECOTGY1 K01197 (in) Sikes,C.S. and Wheeler,A.P. (Eds.); Surface reactive peptides and polymers. Discovery and commercialization.: 186-200, American Chemical Society, Washington, D.C. (1991) -> ECOTGP J01714 (in) Sund,H. and Blauer,G. (Eds.); Protein-Ligand Interactions: 193-207, Walter de Gruyter, New York (1975) -> ECOLAC J01636 (in) Wu,R. and Grossman,L. (Eds.); Methods in Enzymology, Recombinant DNA, part E: In press, Academic Press, New York, N.Y. (1986) -> PLMCG M11320 Acta Microbiol. Pol. 35, 175-190 (1986) -> ECOTGG1 M54893 Actinomycetologica 5, 14-17 (1991) -> STMARGG D00799 Adv. Biophys. 21, 115-133 (1986) -> R10REP M26840 Adv. Biophys. 21, 175-192 (1986) -> ECONUSAA M26839 Adv. Enzyme Regul. 21, 225-237 (1983) -> ECOPURFA M26893 Adv. Exp. Med. Biol. 195, 239-246 (1986) -> ECOAPT M14040 Agric. Biol. Chem. 50, 2155-2158 (1986) -> ECONANA M20207 Agric. Biol. Chem. 50, 2771-2778 (1986) -> BRLAM330 D00038 Agric. Biol. Chem. 51, 2019-2022 (1987) -> BACCGT D00129 Agric. Biol. Chem. 51, 2641-2648 (1987) -> STRSAGP D00219 Agric. Biol. Chem. 51, 2807-2809 (1987) -> BACPGECR M35503 Agric. Biol. Chem. 51, 3133-3135 (1987) -> BACXYLAP D00312 Agric. Biol. Chem. 51, 455-463 (1987) -> BACHDCRY D00117 Agric. Biol. Chem. 51, 953-955 (1987) -> BACXYNAA D00087 Agric. Biol. Chem. 52, 1565-1573 (1988) -> BACIP135 D00348 Agric. Biol. Chem. 52, 1785-1789 (1988) -> BACTMR D00343 Agric. Biol. Chem. 52, 2243-2246 (1988) -> PSEGI D00342 Agric. Biol. Chem. 52, 399-406 (1988) -> BACAMYEB M35517 Agric. Biol. Chem. 52, 479-487 (1988) -> ECAPALI D00217 ------------------------------------------------------------------------------ Table 7. Part of the contents in the file 'ddbjbct.key'. For the locus and accession number respectively given on the right to the arrow, the corresponding key words are listed on the left. ------------------------------------------------------------------------------ A.aceti acetic acid resistance protein (aarA) gene, complete cds. -> ABCAARAA M34830 acetic acid resistance protein. -> ABCAARAA M34830 Cloning of genes responsible for acetic acid resistance in acetobacter aceti -> ABCAARAA M34830 A. polyoxogenes alcohol dehydrogenase (EC 1.1.99.8) and cytochrome c genes. -> ABCADHCC D00635 alcohol dehydrogenase; cytochrome c. -> ABCADHCC D00635 Cloning and sequencing of the gene cluster encoding two subunits of membrane- bound alcohol dehydrogenase from Acetobacter polyoxogenes -> ABCADHCC D00635 These data kindly submitted in computer readable form by: Toshimi Tamaki Nakano Central Biochemical Institute 2-6 Nakamura-cho Handa-shi, Aichi-ken 475 Japan Phone: 0569-21-3331 Fax: 0569-23-8486 -> ABCADHCC D00635 A.polyoxogenes membrane-bound aldehyde dehydrogenase gene, complete cds and flanks. -> ABCALDH D00521 aldehyde dehydrogenase gene; ethanol oxidation; membrane-bound enzyme. -> ABCALDH D00521 Nucleotide sequence of the membrane-bound aldehyde dehydrogenase gene from Acetobacter polyoxogenes -> ABCALDH D00521 ------------------------------------------------------------------------------ Table 8. Part of the contents in the file 'ddbjbct.org'. For the locus and accession number respectively given on the right to the arrow, the corresponding taxonomic names are listed on the left. They are arranged in the alphabetical order of the species names. ------------------------------------------------------------------------------ A. nidulans 6301 DNA. Anacystis nidulans Prokaryota; Bacteria; Gracilicutes; Oxyphotobacteria; Cyanobacteria. -> ANIRUBPS X00019 A. nidulans DNA, clone pAN4. Anacystis nidulans Prokaryota; Bacteria; Gracilicutes; Oxyphotobacteria; Cyanobacteria. -> ANIRGGX X00343 A. nidulans DNA. Anacystis nidulans Prokaryota; Bacteria; Gracilicutes; Oxyphotobacteria; Cyanobacteria. -> ANIRGG X00512 A. polyoxogenes genomic DNA. Acetobacter polyoxogenes Prokaryota; Bacteria; Gracilicutes; Scotobacteria; Aerobic rods and cocci; Azotobacteraceae. - > ABCADHCC D00635 A. quadruplicatum (strain PR-6) DNA, clone pAQPR1. Agmenellum quadruplicatum Prokaryota; Bacteria; Gracilicutes; Oxyphotobacteria; Cyanobacteria. -> AQUPCAB K02660 A. quadruplicatum (strain PR6) DNA. Agmenellum quadruplicatum Prokaryota; Bacteria; Gracilicutes; Oxyphotobacteria; Cyanobacteria. -> AQUCPCAB K02659 A. vinelandii DNA. Azotobacter vinelandii Prokaryota; Bacteria; Gracilicutes; Scotobacteria; Aerobic rods and cocci; Azotobacteraceae. -> AVINIFUSV M17349 A.aceti (strain 10-8) DNA, clone pAR1611. Acetobacter aceti Prokaryota; Bacteria; Gracilicutes; Scotobacteria; Aerobic rods and cocci; Azotobacteraceae. -> ABCAARAA M34830 A.actinomycetemcomitans (strain JP2) DNA, clone lambda-OP8. Actinobacillus actinomycetemcomitans Prokaryota; Bacteria; Gracilicutes; Scotobacteria; Facultatively anaerobic rods; Pasteurellaceae. -> ACNLKTXN M27399 A.anitratum DNA, clone pLJD1. Acinetobacter anitratum Prokaryota; Bacteria; Gracilicutes; Scotobacteria; Neisseriaceae. -> ACCCITSYN M33037 ------------------------------------------------------------------------------ Table 9. Part of the short directory file in DDBJ style in the file 'ddbjbct.sdr'. The short directory file contains brief descriptions of all of the sequence entries contained in the DDBJ style. ------------------------------------------------------------------------------ ABCAARAA A.aceti acetic acid resistance protein (aarA) gene, complete 1624bp ABCADHCC A. polyoxogenes alcohol dehydrogenase (EC 1.1.99.8) and 4230bp ABCALDH A.polyoxogenes membrane-bound aldehyde dehydrogenase gene, 2683bp ABCBCSABCD A.xylinum bcs A, B, C and D genes, complete cds's. 9540bp ABCCELA Acetobacter xylinum UDP pyrophosphorylase (celA) gene, 1165bp ABCCELSYN A. xylinum gene for cellulose biosynthesis 5363bp ABCIS1380 A.pasteurianus insertion sequence IS1380. 1665bp ACAADH1 Acetobacter aceti(K6033) alcohol dehydrogenase subunit 2467bp ACCAAC2 Acinetobacter baumannii aminoglycoside acetyltransferase 1123bp ACCACEAA A.baumannii chloramphenicol acetyltransferase (cat) gene, 1874bp ACCAPHA6 Acinetobacter baumannii aphA-6 gene. 1170bp ACCBENABCA A.calcoaceticus BenA, BenB, BenC, BenD, and BenE proteins 15922bp ACCCAT Acinetobacter calcoaceticus cat operon. 15922bp ACCCATAM A.calcoaceticus catA and catM genes, encoding catechol 1, 5537bp ACCCHMO Acinetobacter sp. cyclohexanone monooxygenase gene, complete 2128bp ACCCITSYN A.anitratum citrate synthase gene, complete cds. 1895bp ------------------------------------------------------------------------------ In addition to the 9 tables the four following index files are included in this release. These files were prepared irrespective of the 14 categories of taxonomic divisions. Accession number index file Keyword phrase index file Journal citation index file Gene name index file A brief description is given for each file in the following. Table 10. Part of the accession number index file in the 'ddbjacc.idx'. The following excerpt from the accession number index file illustrates the format of the index. ------------------------------------------------------------------------------ D00100 PSEASPAA BCT D00100 D00101 RABNP450R MAM D00101 D00102 HUMLTX HUM D00102 D00103 AFARRN5SA BCT D00103 AFRRN5SA BCT X05517 D00104 AFARRN5SB BCT D00104 AFRRN5SB BCT X05518 D00105 AFARRN5S BCT D00105 ASRRN5S BCT X05524 D00106 ACH5SRR BCT D00106 AXRRN5S BCT X05522 AXRRN5SA BCT X05523 D00107 ACH5SRRX BCT D00107 ACRRN5S BCT X05521 ------------------------------------------------------------------------------ Table 11. Part of the keyword phrase index file in the 'ddbjkey.idx'. Keyword phrases consist of names for gene products and other characteristics of sequence entries. ------------------------------------------------------------------------------ A CHANNEL DROCHA INV M17155 A COMPONENT SQLCVEA VRL M38183 A LOCUS GORGOGOA3 PRI X54375 GORGOGOA4 PRI X54376 A LOCUS ALLELE GORA0101 PRI X60258 GORA0201 PRI X60259 GORA0401 PRI X60257 GORA0501 PRI X60256 A MULTI-GENE FAMILY RICGLUTE PLN D00584 A PROTEIN MS2AAR PHG M25187 ST1APCS PHG M25396 A SEQUENCE HS5TOA30 VRL D00148 HS5TOA31 VRL D00147 ------------------------------------------------------------------------------ Table 12. Part of the author name index file in 'ddbjaut.idx'. The author name index file lists all of the author names that appear in the citations. ------------------------------------------------------------------------------ ABE,A. HUMMHDRBWE PRI M27509 HUMMHDRBWF PRI M27510 HUMMHDRBWG PRI M27511 YSCGAL11A PLN M22481 ABE,C. S85445 BCT S85445 ABE,E. M23442 UNA M23442 ABE,H. CHKADF VRT M55660 CHKCOF VRT M55659 ABE,K. CHPCLAC PRI D11383 CHPIMRF PRI D11384 CUGCUR09 PLN X64110 CUGCUR37 PLN X64111 HPCCEXPA VRL M55970 HPCCPEP1 VRL D10687 HPCCPEP2 VRL D10688 HPCHABC82 VRL X51587 HPCNS2APA VRL M55972 HPCNS2PA VRL M55971 HPCNS2PB VRL M55973 HPCNS5PA VRL M55974 MUSKE2 ROD M65255 MUSKE2A ROD M65256 MZECYS PLN D10622 RICCPI PLN J03469 RICGLUTE PLN D00584 RICLNOCI PLN J05595 RICOCS PLN M29259 RICORYII PLN X57658 RICOZA PLN D90406 RICOZB PLN D90407 RICOZC PLN D90408 S54524 PLN S54524 S54526 PLN S54526 S54530 PLN S54530 S73960 ROD S73960 ------------------------------------------------------------------------------ Table 13. Part of the journal citation index file in 'ddbjjou.idx'. The journal citation index file lists all of the citations that appear in the references. ------------------------------------------------------------------------------ ACTA BIOCHIM. BIOPHYS. SIN. 23, 246-253 (1992) HUMPLASINS HUM M98056 ACTA BIOCHIM. BIOPHYS. SIN. 28, 233-239(1996) TKTII PLN X82230 ACTA BIOCHIM. POL. 24, 301-318 (1977) LUPTRFJ PLN K00345 LUPTRFN PLN K00346 ACTA BIOCHIM. POL. 26, 369-381(1979) HVTRNPHE PLN X02683 ACTA BIOCHIM. POL. 29, 143-149 (1982) EMEMTA PLN M32572 EMEMTB PLN M32573 EMEMTC PLN M32574 EMEMTD PLN M32575 EMEMTE PLN M32576 ACTA BIOCHIM. POL. 34, 21-27 (1987) LUPNOSP PLN M32571 ------------------------------------------------------------------------------ Table 14. Part of the gene name index file in 'ddbjgen.idx'. This file lists all the gene names that appear in the feature table. ------------------------------------------------------------------------------ AACC8 STMAACC8 BCT M55426 AACC9 MPUAACC9 BCT M55427 AACT HUMA1ACM PRI K01500 HUMA1ACMA PRI X00947 HUMA1ACMB PRI M18035 HUMAACT1 PRI M18906 HUMAACT2 PRI M22533 HUMAACTA PRI J05176 AAD INTINTORF BCT L06418 LMOMO229D BCT X17478 AAD A1 ENTAAC3VI BCT M88012 AAD9 ENEAAD9A BCT M69221 AADA LMOMO229A BCT X17479 S52249 BCT S52249 SYNAADA SYN M60473 TRNTAAB BCT M55547 TRNTN21CAS BCT M86913 ------------------------------------------------------------------------------ The files in this release are arranged in the following order with non- labeled format. Release note ddbjrel.txt 1014 records Category for bacteria, 103562 entries, 279177108 bases ddbjbct.seq 11513649 records Category for EST1 (expressed sequence tag), 100000 entries, 37317616 bases ddbjest1.seq 5900493 records Category for EST2 (expressed sequence tag), 100000 entries, 41136721 bases ddbjest2.seq 5783465 records Category for EST3 (expressed sequence tag), 100000 entries, 37307947 bases ddbjest3.seq 5740314 records Category for EST4 (expressed sequence tag), 100000 entries, 32463761 bases ddbjest4.seq 5985120 records Category for EST5 (expressed sequence tag), 100000 entries, 38755506 bases ddbjest5.seq 5688685 records Category for EST6 (expressed sequence tag), 100000 entries, 40094624 bases ddbjest6.seq 5577300 records Category for EST7 (expressed sequence tag), 100000 entries, 38953341 bases ddbjest7.seq 5596886 records Category for EST8 (expressed sequence tag), 100000 entries, 38761582 bases ddbjest8.seq 5614818 records Category for EST9 (expressed sequence tag), 100000 entries, 39084649 bases ddbjest9.seq 5591534 records Category for EST10 (expressed sequence tag), 100000 entries, 39380784 bases ddbjest10.seq 5553278 records Category for EST11 (expressed sequence tag), 100000 entries, 41939437 bases ddbjest11.seq 5652222 records Category for EST12 (expressed sequence tag), 100000 entries, 43597082 bases ddbjest12.seq 5571058 records Category for EST13 (expressed sequence tag), 100000 entries, 40483099 bases ddbjest13.seq 5210871 records Category for EST14 (expressed sequence tag), 100000 entries, 39893263 bases ddbjest14.seq 5488399 records Category for EST15 (expressed sequence tag), 100000 entries, 41438079 bases ddbjest15.seq 5743556 records Category for EST16 (expressed sequence tag), 100000 entries, 44377526 bases ddbjest16.seq 5718561 records Category for EST17 (expressed sequence tag), 100000 entries, 41156479 bases ddbjest17.seq 5549899 records Category for EST18 (expressed sequence tag), 100000 entries, 44406403 bases ddbjest18.seq 5727883 records Category for EST19 (expressed sequence tag), 100000 entries, 42090211 bases ddbjest19.seq 5815819 records Category for EST20 (expressed sequence tag), 100000 entries, 42579742 bases ddbjest20.seq 5556229 records Category for EST21 (expressed sequence tag), 100000 entries, 55005775 bases ddbjest21.seq 5341091 records Category for EST22 (expressed sequence tag), 100000 entries, 64559795 bases ddbjest22.seq 4965727 records Category for EST23 (expressed sequence tag), 100000 entries, 53516056 bases ddbjest23.seq 4800081 records Category for EST24 (expressed sequence tag), 100000 entries, 31412591 bases ddbjest24.seq 5641408 records Category for EST25 (expressed sequence tag), 100000 entries, 25945423 bases ddbjest25.seq 6047543 records Category for EST26 (expressed sequence tag), 100000 entries, 27530073 bases ddbjest26.seq 7637624 records Category for EST27 (expressed sequence tag), 100000 entries, 24763593 bases ddbjest27.seq 8795682 records Category for EST28 (expressed sequence tag), 100000 entries, 44013998 bases ddbjest28.seq 4846237 records Category for EST29 (expressed sequence tag), 100000 entries, 46543985 bases ddbjest29.seq 4775753 records Category for EST30 (expressed sequence tag), 100000 entries, 52554302 bases ddbjest30.seq 5229558 records Category for EST31 (expressed sequence tag), 100000 entries, 43509849 bases ddbjest31.seq 5700363 records Category for EST32 (expressed sequence tag), 100000 entries, 43902342 bases ddbjest32.seq 6099263 records Category for EST33 (expressed sequence tag), 100000 entries, 42519309 bases ddbjest33.seq 5851859 records Category for EST34 (expressed sequence tag), 100000 entries, 40584718 bases ddbjest34.seq 5288399 records Category for EST35 (expressed sequence tag), 100000 entries, 39560959 bases ddbjest35.seq 5893762 records Category for EST36 (expressed sequence tag), 100000 entries, 44425575 bases ddbjest36.seq 6145874 records Category for EST37 (expressed sequence tag), 100000 entries, 45791765 bases ddbjest37.seq 5556216 records Category for EST38 (expressed sequence tag), 100000 entries, 41390216 bases ddbjest38.seq 5730027 records Category for EST39 (expressed sequence tag), 100000 entries, 37388512 bases ddbjest39.seq 5575677 records Category for EST40 (expressed sequence tag), 100000 entries, 40312727 bases ddbjest40.seq 6209380 records Category for EST41 (expressed sequence tag), 100000 entries, 27091828 bases ddbjest41.seq 8722498 records Category for EST42 (expressed sequence tag), 100000 entries, 27520016 bases ddbjest42.seq 8622511 records Category for EST43 (expressed sequence tag), 100000 entries, 28106650 bases ddbjest43.seq 8688045 records Category for EST44 (expressed sequence tag), 100000 entries, 27207680 bases ddbjest44.seq 8548594 records Category for EST45 (expressed sequence tag), 100000 entries, 27869402 bases ddbjest45.seq 8418009 records Category for EST46 (expressed sequence tag), 100000 entries, 28900350 bases ddbjest46.seq 7886688 records Category for EST47 (expressed sequence tag), 100000 entries, 42048306 bases ddbjest47.seq 5718495 records Category for EST48 (expressed sequence tag), 100000 entries, 42125819 bases ddbjest48.seq 5593169 records Category for EST49 (expressed sequence tag), 100000 entries, 56225133 bases ddbjest49.seq 5457736 records Category for EST50 (expressed sequence tag), 100000 entries, 55072917 bases ddbjest50.seq 5464971 records Category for EST51 (expressed sequence tag), 100000 entries, 46151488 bases ddbjest51.seq 5497795 records Category for EST52 (expressed sequence tag), 100000 entries, 58615104 bases ddbjest52.seq 5723725 records Category for EST53 (expressed sequence tag), 100000 entries, 47339405 bases ddbjest53.seq 5719103 records Category for EST54 (expressed sequence tag), 100000 entries, 52854881 bases ddbjest54.seq 5811804 records Category for EST55 (expressed sequence tag), 100000 entries, 58821936 bases ddbjest55.seq 5503331 records Category for EST56 (expressed sequence tag), 100000 entries, 55090866 bases ddbjest56.seq 6104683 records Category for EST57 (expressed sequence tag), 100000 entries, 55007125 bases ddbjest57.seq 5742905 records Category for EST58 (expressed sequence tag), 100000 entries, 59845504 bases ddbjest58.seq 5727197 records Category for EST59 (expressed sequence tag), 100000 entries, 64065308 bases ddbjest59.seq 5627256 records Category for EST60 (expressed sequence tag), 100000 entries, 40954688 bases ddbjest60.seq 5934225 records Category for EST61 (expressed sequence tag), 100000 entries, 51968008 bases ddbjest61.seq 6141845 records Category for EST62 (expressed sequence tag), 100000 entries, 56662307 bases ddbjest62.seq 5773968 records Category for EST63 (expressed sequence tag), 100000 entries, 55831300 bases ddbjest63.seq 5847427 records Category for EST64 (expressed sequence tag), 100000 entries, 43056783 bases ddbjest64.seq 5650476 records Category for EST65 (expressed sequence tag), 100000 entries, 39516098 bases ddbjest65.seq 5711588 records Category for EST66 (expressed sequence tag), 100000 entries, 53422545 bases ddbjest66.seq 5729795 records Category for EST67 (expressed sequence tag), 100000 entries, 54750376 bases ddbjest67.seq 5717934 records Category for EST68 (expressed sequence tag), 100000 entries, 65057087 bases ddbjest68.seq 5568457 records Category for EST69 (expressed sequence tag), 100000 entries, 62114060 bases ddbjest69.seq 5833574 records Category for EST70 (expressed sequence tag), 100000 entries, 67031106 bases ddbjest70.seq 5677941 records Category for EST71 (expressed sequence tag), 100000 entries, 37999563 bases ddbjest71.seq 4573442 records Category for EST72 (expressed sequence tag), 100000 entries, 32524095 bases ddbjest72.seq 4600368 records Category for EST73 (expressed sequence tag), 100000 entries, 36229324 bases ddbjest73.seq 6010312 records Category for EST74 (expressed sequence tag), 100000 entries, 36634488 bases ddbjest74.seq 5666520 records Category for EST75 (expressed sequence tag), 100000 entries, 35775876 bases ddbjest75.seq 5695375 records Category for EST76 (expressed sequence tag), 100000 entries, 35245809 bases ddbjest76.seq 5600761 records Category for EST77 (expressed sequence tag), 100000 entries, 39890099 bases ddbjest77.seq 5848039 records Category for EST78 (expressed sequence tag), 2800 entries, 1001097 bases ddbjest78.seq 128696 records Category for GSS1 (genome survey sequence), 100000 entries, 64958480 bases ddbjgss1.seq 4723526 records Category for GSS2 (genome survey sequence), 100000 entries, 80231190 bases ddbjgss2.seq 5726976 records Category for GSS3 (genome survey sequence), 100000 entries, 88567956 bases ddbjgss3.seq 6226265 records Category for GSS4 (genome survey sequence), 100000 entries, 51778634 bases ddbjgss4.seq 5006236 records Category for GSS5 (genome survey sequence), 100000 entries, 41161005 bases ddbjgss5.seq 4993623 records Category for GSS6 (genome survey sequence), 100000 entries, 47407756 bases ddbjgss6.seq 5063608 records Category for GSS7 (genome survey sequence), 100000 entries, 52248867 bases ddbjgss7.seq 5486487 records Category for GSS8 (genome survey sequence), 100000 entries, 50966675 bases ddbjgss8.seq 5528268 records Category for GSS9 (genome survey sequence), 100000 entries, 50229095 bases ddbjgss9.seq 5666606 records Category for GSS10 (genome survey sequence), 100000 entries, 50565355 bases ddbjgss10.seq 5601104 records Category for GSS11 (genome survey sequence, 100000 entries, 50906933 bases ddbjgss11.seq 5857184 records Category for GSS12 (genome survey sequence), 100000 entries, 55648567 bases ddbjgss12.seq 5650193 records Category for GSS13 (genome survey sequence), 100000 entries, 52821057 bases ddbjgss13.seq 6065899 records Category for GSS14 (genome survey sequence), 100000 entries, 50041360 bases ddbjgss14.seq 5793407 records Category for GSS15 (genome survey sequence), 100000 entries, 46139413 bases ddbjgss15.seq 6067159 records Category for GSS16 (genome survey sequence), 100000 entries, 57742948 bases ddbjgss16.seq 5600497 records Category for GSS17 (genome survey sequence), 100000 entries, 46284824 bases ddbjgss17.seq 6304878 records Category for GSS18 (genome survey sequence), 100000 entries, 50797017 bases ddbjgss18.seq 7095670 records Category for GSS19 (genome survey sequence), 100000 entries, 49020068 bases ddbjgss19.seq 6784053 records Category for GSS20 (genome survey sequence), 100000 entries, 50010570 bases ddbjgss20.seq 6729261 records Category for GSS21 (genome survey sequence), 100000 entries, 58353943 bases ddbjgss21.seq 6135485 records Category for GSS22 (genome survey sequence), 100000 entries, 40993526 bases ddbjgss22.seq 6836798 records Category for GSS23 (genome survey sequence), 100000 entries, 50141893 bases ddbjgss23.seq 5925385 records Category for GSS24 (genome survey sequence), 78901 entries, 33846743 bases ddbjgss24.seq 3893362 records Category for HTC (high throughput cDNA), 19168 entries, 23439085 bases ddbjhtc.seq 2256769 records Category for HTG1 (high throughput genome sequence), 3000 entries, 443902997 bases ddbjhtg1.seq 7765098 records Category for HTG2 (high throughput genome sequence), 3000 entries, 258762154 bases ddbjhtg2.seq 4579321 records Category for HTG3 (high throughput genome sequence), 3000 entries, 264153208 bases ddbjhtg3.seq 4691933 records Category for HTG4 (high throughput genome sequence), 3000 entries, 284023479 bases ddbjhtg4.seq 4991092 records Category for HTG5 (high throughput genome sequence), 3000 entries, 447502575 bases ddbjhtg5.seq 7940216 records Category for HTG6 (high throughput genome sequence), 3000 entries, 403054565 bases ddbjhtg6.seq 7150781 records Category for HTG7 (high throughput genome sequence), 3000 entries, 2430021 bases ddbjhtg7.seq 167918 records Category for HTG8 (high throughput genome sequence), 3000 entries, 35057768 bases ddbjhtg8.seq 735581 records Category for HTG9 (high throughput genome sequence), 3000 entries, 29152592 bases ddbjhtg9.seq 637380 records Category for HTG10 (high throughput genome sequence), 3000 entries, 15714111 bases ddbjhtg10.seq 398702 records Category for HTG11 (high throughput genome sequence), 3000 entries, 25327775 bases ddbjhtg11.seq 570043 records Category for HTG12 (high throughput genome sequence), 3000 entries, 35618843 bases ddbjhtg12.seq 748922 records Category for HTG13 (high throughput genome sequence), 3000 entries, 12298528 bases ddbjhtg13.seq 339856 records Category for HTG14 (high throughput genome sequence), 3000 entries, 9903881 bases ddbjhtg14.seq 297645 records Category for HTG15 (high throughput genome sequence), 3000 entries, 17452055 bases ddbjhtg15.seq 426574 records Category for HTG16 (high throughput genome sequence), 3000 entries, 31949541 bases ddbjhtg916seq 682474 records Category for HTG17 (high throughput genome sequence), 3000 entries, 22534260 bases ddbjhtg17.seq 518478 records Category for HTG18 (high throughput genome sequence), 3000 entries, 26219667 bases ddbjhtg18.seq 581016 records Category for HTG19 (high throughput genome sequence), 3000 entries, 19054282 bases ddbjhtg19.seq 455402 records Category for HTG20 (high throughput genome sequence), 3000 entries, 261157006 bases ddbjhtg20.seq 4693635 records Category for HTG21 (high throughput genome sequence), 3000 entries, 98537017 bases ddbjhtg21.seq 1827241 records Category for HTG22 (high throughput genome sequence), 3000 entries, 120251813 bases ddbjhtg22.seq 2188501 records Category for HTG23 (high throughput genome sequence), 3000 entries, 167286039 bases ddbjhtg23.seq 3014139 records Category for HTG24 (high throughput genome sequence), 3000 entries, 39778935 bases ddbjhtg24.seq 823476 records Category for HTG25 (high throughput genome sequence), 3000 entries, 111752994 bases ddbjhtg25.seq 2090747 records Category for HTG26 (high throughput genome sequence), 3000 entries, 94011780 bases ddbjhtg26.seq 1793812 records Category for HTG27 (high throughput genome sequence), 3000 entries, 292478863 bases ddbjhtg27.seq 5246185 records Category for HTG28 (high throughput genome sequence), 3000 entries, 503762545 bases ddbjhtg28.seq 8766498 records Category for HTG29 high throughput genome sequence), 2639 entries, 422910174 bases ddbjhtg29.seq 7340778 records Category for human1, 30000 entries, 705781413 bases ddbjhum1.seq 14772913 records Category for human2, 30000 entries, 65939111 bases ddbjhum2.seq 2511020 records Category for human3, 30000 entries, 565952140 bases ddbjhum3.seq 12444104 records Category for human4, 30000 entries, 43464579 bases ddbjhum4.seq 2067768 records Category for human5, 29843 entries, 56228037 bases ddbjhum5.seq 2244437 records Category for invertebrates, 85695 entries, 424012276 bases ddbjinv.seq 11821490 records Category for mammals, 29902 entries, 26276038 bases ddbjmam.seq 1678428 records Category for patents, 306224 entries, 122586546 bases ddbjpat.seq 8800044 records Category for phages, 1686 entries, 4933933 bases ddbjphg.seq 218824 records Category for plants, 151229 entries, 375599098 bases ddbjpln.seq 13798825 records Category for primates, 11086 entries, 11030309 bases ddbjpri.seq 663001 records Category for rodents, 64875 entries, 120604697 bases ddbjrod.seq 4996177 records Category for STS (sequence tagged site), 167269 entries, 97049427 bases ddbjsts.seq 10366518 records Category for synthetic DNAs, 4248 entries, 10936653 bases ddbjsyn.seq 392657 records Category for unannotated sequences, 481 entries, 284634 bases ddbjuna.seq 21532 records Category for viruses, 116841 entries, 102064496 bases ddbjvrl.seq 7149020 records Category for vertebrates, 53664 entries, 48756140 bases ddbjvrt.seq 3059906 records Accession number index file ddbjacc.idx 11462606 records Keyword phrase index file ddbjkey.idx 4188131 records Journal citation index file ddbjjou.idx 6448631 records Gene name index file ddbjgen.idx 615786 records