DNA Data Bank of Japan DNA Database Release 68.0, Dec. 2006, including 64,267,978 entries, 68,259,314,742 bases ------------------------------------------------------------------------------- Table of contents ------------------------------------------------------------------------------- 1. Introduction 1.1. Announcement for changes in the present release 1.2. Announcement for the forthcoming changes 2. DDBJ flat file format 2.1. LOCUS line 2.2. DEFINITION line 2.3. ACCESSION line 2.4. VERSION line 2.5. KEYWORDS line 2.6. SOURCE line 2.7. REFERENCE line 2.8. COMMENT line 2.9. FEATURES line 2.10. BASE COUNT line 2.11. ORIGIN line 3. Dataset categories 3.1. Division categories 3.2. TPA separated from primary dataset 3.3. Notice for patented data 4. DDBJ staff 5. Acknowledgment 6. File Contents 6.1. File categories 6.2. File types 7. Sample of the contents in each file 7.1. Part of the contents in the file 'ddbjbct1.seq' 7.2. Part of the contents in the file 'ddbjbct1.acc' 7.3. Part of the contents in the file 'ddbjbct1.aut' 7.4. Part of the contents in the directory file 'ddbjbct1.dir' 7.5. Part of the contents in the file 'ddbjbct1.idx' 7.6. Part of the contents in the file 'ddbjbct1.jou' 7.7. Part of the contents in the file 'ddbjbct1.key' 7.8. Part of the contents in the file 'ddbjbct1.org' 7.9. Part of the contents in the short directory file 'ddbjbct1.sdr' 7.10. Part of the contents in the accession number index file 'ddbjacc1.idx' 7.11. Part of the contents in the keyword phrase index file 'ddbjkey1.idx' 7.12. Part of the contents in the journal citation index file 'ddbjjou1.idx' 7.13. Part of the contents in the gene name index 'ddbjgen.idx' 8. Release history 9. File list ------------------------------------------------------------------------------- 1. Introduction This database contains nucleotide sequence data for any organism, not only those with DNA genomes but also those with RNA genomes. This database may be copied and redistributed without permission on the condition that all the statements in this release note are reproduced in each copy. See also '3.3. Notice for patented data' below. The present release contains the newest data prepared by the DNA Data Bank of Japan (DDBJ), GenBank (*), and European Molecular Biology Laboratory/European Bioinformatics Institute (EMBL/EBI) as of November 24, 2006. This unified database was made possible thanks to the international collaboration among the three data banks. All the entries have accordingly been annotated using the feature keys common to them. *'GenBank' is a trademark of NIH, USA, and is operated by National Center for Biotechnology Information (NCBI) at NIH. 1.1. Announcement for changes in the present release Split of files: From the present release, we change the maximum file size from 300 MB to 1.5 GB, because the network capacity has been remarkably increased. Each file named as ddbj***##.seq has at most 1.5 GB storage capacity. See also the sections, '6. File Contents' and '9. File list'. 1.2. Announcement for the forthcoming changes Introduction of the project ID at PROJECT line in DDBJ flat file: Following the agreement at the INSD collaborative meeting in 2006, INSDC has started to assign the project ID for submissions from a genome project. The description of project ID is shown as below; ---------------------------------------------------------------------------- A unique identifier, assigned at the time of the submission by a genome project that informed INSDC of the submission beforehand. It is recommended that the submitter quotes the assigned project ID in all communication with INSDC to allow for easier and faster tracking of issues. The project ID field provides an umbrella identifier that points to all related sequence data for the project. ---------------------------------------------------------------------------- The PROJECT lines will contain INSDC-assigned ID for the genome project. It will be appeared between VERSION and KEYWORDS lines in DDBJ flat files, from the next DDBJ periodical release, 69 (March 2007) as shown below. See also 2. 'DDBJ flat file format'. ---------------------------------------------------------------------------- ACCESSION AB012345 VERSION AB012345.1 PROJECT GenomeProject:123 KEYWORDS . ---------------------------------------------------------------------------- At DDBJ, the retrofit to add the PROJECT lines for genome projects will be completed by the periodical release 70 to be published in June, 2007. Please note that during this transitional period, some of them will be retrofitted. Termination of providing the index files for each category: For users logging in one of our computers (supernig), we have provided index files for each category (See also '6.2. File types' and '7. Sample of the contents in each file'). However, since the computer system in our institute will soon be replaced with an upgraded one which does not work as supernig, we will terminate providing the index files. The replacement of the computer system is mentioned on following URL; http://www.ddbj.nig.ac.jp/replace/replace-e.html 2. DDBJ flat file format The database is a collection of "entry" which is the unit of the data. The entries submitted to databanks were processed and publicized according to the DDBJ format for distribution (flat file). The flat file includes the sequence and the information of submitters, references, source organisms, and "feature" information, etc. The items of the DDBJ flat file are explained at following; ------------------------------------------------------------------------------- LOCUS AB000000 450 bp mRNA linear HUM 08-JUL-2002 DEFINITION Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds. ACCESSION AB000000 VERSION AB000000.1 KEYWORDS . SOURCE Homo sapiens ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 450) AUTHORS Mishima,H. and Shizuoka,T. TITLE Direct Submission JOURNAL Submitted (30-NOV-2000) to the DDBJ/EMBL/GenBank databases. Hanako Mishima, National Institute of Genetics, DNA Data Bank of Japan; Yata 1111, Mishima, Shizuoka 411-8540, Japan (E-mail:mishima@supernig.nig.ac.jp, Tel:81-55-981-6853, Fax:81-55-981-6849) REFERENCE 2 (sites) AUTHORS Mishima,H., Shizuoka,T. and Fuji,I. TITLE Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver JOURNAL Unpublished (2002) COMMENT Human cDNA sequencing project. FEATURES Location/Qualifiers source 1..450 /chromosome="12" /clone="GT200015" /clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)" /map="12p13" /mol_type="mRNA" /organism="Homo sapiens" /tissue_type="liver" CDS 86..>450 /codon_start=1 /gene="GAPD" /product="glyceraldehyde-3-phosphate dehydrogenase" /protein_id="BAA12345.1" /transl_table=1 /translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV" BASE COUNT 102 a 119 c 131 g 98 t ORIGIN 1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct 61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg 121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc 181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt 241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg 301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac 361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc 421 tcaacttaag ggtggtgcta agaaggtctg // ------------------------------------------------------------------------------- 2.1. LOCUS line The format of LOCUS line in the flat file is shown below; --------- -------- Positions Contents --------- -------- 01-05 'LOCUS' 06-12 spaces 13-28 Locus name 29-29 space 30-40 Length of sequence, right-justified 41-41 space 42-43 'bp' 44-47 spaces 48-54 DNA, RNA, mRNA, pre-RNA, rRNA, scRNA, snRNA, snoRNA, tRNA, left justified 55-55 space 56-63 'linear' followed by two spaces, or 'circular' 64-64 space 65-67 The division code (see '3.1. Division categories') 68-68 space 69-79 Date, in the form dd-MMM-yyyy (e.g., 08-JUL-2002) ------------------------------------------------------------------------------ 2.2. DEFINITION line The definition briefly describes the information of gene(s). "DEFINITION" is constructed by each of the three data banks. 2.3. ACCESSION line This line shows accession number of the entry data. A unique accession number is issued to the data submitter by each of the three data banks. The accession number is composed of 1 alphabet character and 5 digits (ex. A12345) or 2 alphabet characters and 6 digits (ex. AB123456). The former style was used in 1980s, but later the latter style was introduced because of data explosion. All the entries designated by the accession numbers with the prefixes given below have been collected and processed by DDBJ, and the rest have been done by GenBank and EMBL/EBI. ------------------------------------------------------------------------------- C, D, E, AB, AG, AK, AP, AT, AU, AV, BA, BB, BD, BJ, BP, BR, BS, BW, BY, CI, CJ, DA, DB, DD, DE, DF, DG ------------------------------------------------------------------------------- You can find the list of the prefixes of the accession numbers at the following URL; http://www.ddbj.nig.ac.jp/sub/prefix.html If multiple entries are united to an entry, or if an entry is extensively modified after the submission, the responsible data banks may assign a new accession number to it. In these cases, the new accession number is called the primary accession number, and the old accession number(s) is/are called the secondary accession number(s). In the flat file, the primary accession number is indicated first, then the secondary accession number(s) follows. You can find the same updated entry with both the primary and the secondary accession numbers. 2.4. VERSION line This line consists of an accession number and a version number, like "AB123456.1", in which the digit(s) after the period is a version number. The data open to public for the first time is version number as "1". The reason for adding VERSION is that since a released sequence sometimes revised by the submitter, the accession number alone cannot specify the sequence in question causing the user a trouble. The number is increased by one every time when a revised sequence is made public. 2.5. KEYWORDS line The data banks describe this line, if necessary. In many cases, the categories of the data (EST, HTG etc.), gene names and product names included in "KEYWORDS". 2.6. SOURCE line This line shows the scientific name on organism from which the sequence is obtained and an organelle type if the sequence is derived from an organelle other than the nucleus. 2.7. REFERENCE line The information on the submitters and references related to the submitted sequence is indicated in REFERENCE line. 2.8. COMMENT line. The information about an entry that can not be described using FEATURES or the other fields. 2.9. FEATURES line Biological features of a submitted sequence data are described with "Feature" key (the biological nature of the annotated feature), "Location" (the region of the sequence which corresponds to Feature), and "Qualifier" (supplementary information about Feature). The "Feature" and "Qualifier" keys used in the present release is defined by DDBJ/EMBL/GenBank Feature Table: Definition (Version 6.6 October, 2006). The document is continuously updated every half year. You can find its newest version on URL; http://www.ddbj.nig.ac.jp/FT/full_index.html 2.10. BASE COUNT line In the BASE COUNT line of the DDBJ flat file, 9 digits are allocated for each number of a (adenine), c (cytosine), g(guanine) and t (thymine). In the case of RNA sequence, uracil is indicated as "t" according to the rule of the international nucleotide database. In accordance with the relaxation of sequence length limitation, GenBank had already dropped the BASE COUNT line from their flat file format from GenBank Release 138 (Oct. 2003). DDBJ has decided to maintain the BASE COUNT line in our flat file format from the view that GC contents are still important information to characterize the sequence. 2.11. ORIGIN line The sequence data starts from the next line of ORIGIN. The sequence is indicated as lower case letters, delimited by space per 10 bases, starts a new line by 60 bases. The numbers described at left side of lines mean the ordinal number of the top base of the line. 3. Dataset categories There have been a number of genome projects going on worldwide. Among them human genome projects have probably been most productive and yielded a large number of ordinary sequences, huge amounts of genome sequences and EST (expressed sequence tags). Thus, we DDBJ have the human (HUM) division solely for human sequences and the primate (PRI) division for non-human primate sequences, while PRI division of GenBank database contains human sequences too. Note that the other divisions such as EST, GSS, and HTC may also contain human sequences. The present release is divided into 21 categories of organisms and others. See also '6.1. File categories' and '9. File list' below. The contents of the 21 categories are shown in the following. 3.1. Division categories The first 20 divisions are given below; HUM; human PRI; primates (other than human) ROD; rodents MAM; mammals (other than primates and rodents) VRT; vertebrates (other than mammals) INV; invertebrates (animals other than vertebrates) PLN; plants, fungi, plastids (eukaryotes other than animals) BCT; bacteria (including both Eubacteria and Archaea) VRL; viruses PHG; bacteriophages ENV; sequences obtained via environmental sampling methods SYN; synthetic constructs EST; expressed sequence tags; short single pass cDNA sequences GSS; genome survey sequences; short single pass genomic sequences HTC; high throughput cDNA sequences; The sequence submitted from cDNA sequencing projects except for EST. This division is to include unfinished high throughput cDNA sequences, each of which has 5'UTR and 3'UTR at both ends and part of a coding region. The sequence may also include introns. When the sequence becomes finished later, it moves to the corresponding taxonomic division. HTG; high throughput genomic sequences The sequence submitted mainly from genome sequencing projects which regarded a clone as a sequencing unit. STS; sequence tagged sites The tag site for genome sequencing. The information of chromosome, map, PCR_condition is mandatory for this division. PAT; patented data The data submitted to JPO (Japan Patent Office), EPO (European Patent Office), or USPTO (United States Patent and Trademark Office). See also '3.3. Notice for patented data' in below. UNA; the data not annotated The UNA division is not used for recently submitted sequences. CON; Contig / Constructed To conjugate a series of entries, such as those submitted from a genome project, each of data banks constructs an entry and assign an accession number to a large scale sequence dataset. Such entries are classified into the CON division. The entry in the CON division has the information of joined accession numbers instead of the sequence data. The corresponding entries of the CON entry have been submitted to other divisions. The entries and bases in the CON division are not counted in the released numbers given on the top of the release note. 3.2. TPA separated from primary dataset TPA (Third Party Annotation) data are also available. The TPA data are a complement to the existing DDBJ/EMBL/GenBank comprehensive database of primary nucleotide sequences, which typically result from direct sequencing of cDNAs, ESTs, genomic DNAs etc. Primary entries are defined to be data for which the submitting group has done the sequencing and annotation, and as 'owner' of these data has privileges to submit updates/corrections etc. Primary entries used to build a TPA sequence are those that have been experimentally determined and are publicly available in the DDBJ/EMBL/GenBank databases. They may not be from a proprietary database. The entries and bases in TPA are not counted in the released numbers given on the top of the release note. See also the following URLs; http://www.ddbj.nig.ac.jp/sub/tpa-e.html http://www.insdc.org/TPA.html 3.3. Notice for patented data This release includes PAT division for patented data as described above. The patented data are those which the Japanese Patent Office (JPO), United States Patent and Trademark Office (USPTO), and the European Patent Office (EPO) collected, processed and released. The prefixes of accession numbers for the patented data are shown below; ----------------------- JPO : E, BD, DD USPTO: I, AR, DZ EPO : A, AX, CQ, CS ----------------------- Note also that unauthorized use of the patented data may cause legal issues for which DDBJ takes no responsibility. 4. DDBJ staff This release is published by the following DDBJ staff. Gojobori T, Tateno Y, Nishikawa K, Sugawara H, Saitou N, Okubo K, Ikeo K, Suzuki Y, Fukuchi S, Abe T, Sumiyama K, Ogasawara O, Aono H, Atsumi T, Ejima M, Fukuda D, Gojobori M, Hikino Y, Hirai T, Hoshi N, Ishida K, Kawamoto T, Kohira J, Koike T, Kosuge T, Kusakabe A, Lee K, Li C, Maesako H, Mamiya K, Maruyama M, Maruyama N, Mashima J, Mizunuma T, Murakata N, Nagira S, Nagura M, Nishida S, Nishinomiya N, Nozaki A, Okido T, Sakai K, Shiozawa H, Sugimoto K, Sugita R, Sugiyama F, Suzuki S, Tsuboi M, Tsutsui H, Yamada H, Yamamoto M, and Yokoyama E Center for Information Biology and DNA Data Bank of Japan National Institute of Genetics Research Organization of Information and Systems Mishima 411-8540, Japan Phone: +81 55 981 6853 FAX: +81 55 981 6849 E-mail: ddbj@ddbj.nig.ac.jp (for general inquiry) ddbjsub@ddbj.nig.ac.jp (for data submission) ddbjupdt@ddbj.nig.ac.jp (for updates and notification of publication) WWW: http://www.ddbj.nig.ac.jp/ (for DDBJ WWW server) http://sakura.ddbj.nig.ac.jp/ (for DDBJ sequence data submission system) 5. Acknowledgment We are grateful to NCBI and EMBL/EBI for a firm friendship and an excellent collaboration with us. We also thank the Japanese Patent Office for a steady cooperation with us. The operation of DDBJ is supported by the Ministry of Education, Culture, Sports, Science and Technology, and we would gratefully note this here. DDBJ uses the Super-SINET computer network for data collection, data exchange and various services. 6. File Contents 6.1. File categories This release covers 21 categories (see also '3. Dataset categories'.) of organisms and others as follows: ------------------------------------------------------------------------------ ddbjbct*** Category for bacteria ddbjcon*** Category for CON (contig sequences) ddbjenv*** Category for ENV (environmental samples) ddbjest*** Category for EST (expressed sequence tags) ddbjgss*** Category for GSS (genome survey sequences) ddbjhtc*** Category for HTC (high throughput cDNA sequences) ddbjhtg*** Category for HTG (high throughput genomic sequences) ddbjhum*** Category for human ddbjinv*** Category for invertebrates ddbjmam*** Category for mammals other than primates and rodents ddbjpat*** Category for patents ddbjphg*** Category for phages ddbjpln*** Category for plants ddbjpri*** Category for primates other than human ddbjrod*** Category for rodents ddbjsts*** Category for STS (sequence tagged sites) ddbjsyn*** Category for synthetic DNAs ddbjtpa*** Category for TPA (Third Party Annotation) ddbjuna*** Category for unannotated sequences ddbjvrl*** Category for viruses ddbjvrt*** Category for vertebrates other than mammals ------------------------------------------------------------------------------ Some of above in the present release are recorded in multiple ddbj***.seq files, each of which at most has 1.5 GB storage capacity as follows, respectively. --------------------- ddbjbct : 3 files ddbjest : 89 files ddbjgss : 31 files ddbjhtc : 2 files ddbjhtg : 15 files ddbjhum : 5 files ddbjinv : 2 files ddbjpat : 5 files ddbjpln : 4 files ddbjrod : 5 files ddbjsts : 3 files ddbjvrl : 2 files ddbjvrt : 2 files ddbjcon : 2 files --------------------- 6.2. File types The index files included in this release are ddbjacc#.idx, ddbjgen.idx, ddbjjou#.idx, and ddbjkey#.idx. All of them except ddbjgen.idx are recorded in multiple ddbj****.idx files, each of which at most has 1.5 GB storage capacity. We do not include the index files for each category in this release. However, we will provide the user logging in supernig with them for a while as follows. Each category has the following nine types of files. Note that all the files except for ddbj***.seq are not included in this release as mentioned above. ------------------------------------------------------------------------------ ddbj***.seq List of an entry in DDBJ format, see 7.1. ddbj***.acc List of the accession numbers, see 7.2. ddbj***.aut List of the authors, see 7.3. ddbj***.dir List of the short directory in DDBJ style, see 7.4. ddbj***.idx List of indices, see 7.5. ddbj***.jou List of the journals, see 7.6. ddbj***.key List of the key words, see 7.7. ddbj***.org List of the species names, see 7.8. ddbj***.sdr List of the short directory in DDBJ style, see 7.9. ------------------------------------------------------------------------------ 7. Sample of the contents in each file 7.1. Part of the contents in the file 'ddbjbct1.seq' This shows all pieces of information on one entry in DDBJ format. ------------------------------------------------------------------------------ LOCUS D87069 993 bp mRNA linear BCT 14-APR-2000 DEFINITION Escherichia coli mRNA for RNA polymerase sigma subunit, truncated form of sigma-38, complete cds. ACCESSION D87069 VERSION D87069.1 KEYWORDS RNA polymerase sigma subunit, truncated form of sigma-38. SOURCE Escherichia coli ORGANISM Escherichia coli Bacteria; Proteobacteria; gamma subdivision; Enterobacteriaceae; Escherichia. REFERENCE 1 (bases 1 to 993) AUTHORS Jishage,M. TITLE Direct Submission JOURNAL Submitted (14-AUG-1996) to the DDBJ/EMBL/GenBank databases. Miki Jishage, National Institute of Genetics, Molecular Genetics; Yata 1111, Mishima, Shizuoka 411, Japan (E-mail:mjishage@lab.nig.ac.jp, Tel:0559-81-6742, Fax:0559-81-6746) REFERENCE 2 (bases 1 to 993) AUTHORS Jishage,M. and Ishihama,A. TITLE Variation in RNA polymerase sigma subunit composition within different stocks of Escherichia coli starin W3110 JOURNAL Unpublished (1996) REFERENCE 3 AUTHORS Ivanova,A., Renshaw,M., Guntaka,R. and Eisenstark,A. TITLE DNA base sequence variability in katF (putative sigma factor) gene Escherichia coli JOURNAL Nucleic Acids Res. 20, 5479-5480 (1992) REFERENCE 4 AUTHORS Takayanagi,Y., Tanaka,K. and Takahashi,H. TITLE Structure of the 5' upstream region and the regulation of the rpoS gene of Escherichia coli JOURNAL Mol. Gen. Genet. 243, 525-531 (1994) COMMENT FEATURES Location/Qualifiers source 1..993 /mol_type="mRNA" /organism="Escherichia coli" /strain="W3110" CDS 1..810 /note="the gene has four single base changes, resulting in two amino acid substitutions and an amber mutation" /product="RNA polymerase sigma subunit, truncated form of sigma-38" /protein_id="BAA13238.1" /transl_table=11 /translation="MSQNTLKVHDLNEDAEFDENGVEVFDEKALVEYEPSDNDLAEEE LLSQGATQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLV VKIARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMN QTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNER ITSVDTPLGGDSEKALLDILADEKENGPEDTTQDDDMKQSIVKWLFELNAK" variation 75 /citation=[3] /replace="t" variation 97 /citation=[3] /replace="t" variation 99 /citation=[3] /replace="t" variation 808 /citation=[3] /replace="t" BASE COUNT 254 a 223 c 291 g 225 t ORIGIN 1 atgagtcaga atacgctgaa agttcatgat ttaaatgaag atgcggaatt tgatgagaac 61 ggagttgagg tttttgacga aaaggcctta gtagaatatg aacccagtga taacgatttg 121 gccgaagagg aactgttatc gcagggagcc acacagcgtg tgttggacgc gactcagctt 181 taccttggtg agattggtta ttcaccactg ttaacggccg aagaagaagt ttattttgcg 241 cgtcgcgcac tgcgtggaga tgtcgcctct cgccgccgga tgatcgagag taacttgcgt 301 ctggtggtaa aaattgcccg ccgttatggc aatcgtggtc tggcgttgct ggaccttatc 361 gaagagggca acctggggct gatccgcgcg gtagagaagt ttgacccgga acgtggtttc 421 cgcttctcaa catacgcaac ctggtggatt cgccagacga ttgaacgggc gattatgaac 481 caaacccgta ctattcgttt gccgattcac atcgtaaagg agctgaacgt ttacctgcga 541 accgcacgtg agttgtccca taagctggac catgaaccaa gtgcggaaga gatcgcagag 601 caactggata agccagttga tgacgtcagc cgtatgcttc gtcttaacga gcgcattacc 661 tcggtagaca ccccgctggg tggtgattcc gaaaaagcgt tgctggacat cctggccgat 721 gaaaaagaga acggtccgga agataccacg caagatgacg atatgaagca gagcatcgtc 781 aaatggctgt tcgagctgaa cgccaaatag cgtgaagtgc tggcacgtcg attcggtttg 841 ctggggtacg aagcggcaac actggaagat gtaggtcgtg aaattggcct cacccgtgaa 901 cgtgttcgcc agattcaggt tgaaggcctg cgccgtttgc gcgaaatcct gcaaacgcag 961 gggctgaata tcgaagcgct gttccgcgag taa // ------------------------------------------------------------------------------ 7.2. Part of the contents in the file 'ddbjbct1.acc' The first column refers to the secondary accession number, second column to the locus name, and third to the primary accession number. The primary number may be the same as the secondary number. They are arranged in the ascending order of the secondary accession numbers. ------------------------------------------------------------------------------ D00681 -> AB028210 AB028210 D10012 -> AB010832 AB010832 D10013 -> AB010832 AB010832 D10048 -> AB008452 AB008452 D13563 -> AB018435 AB018435 D13614 -> AB006206 AB006206 D13762 -> AB063629 AB063629 D14537 -> AB040412 AB040412 D14604 -> AB001637 AB001637 D14607 -> AB027308 AB027308 ------------------------------------------------------------------------------ 7.3. Part of the contents in the file 'ddbjbct1.aut' For each author name given on the left to the arrow, the corresponding locus name and primary accession number are respectively listed on the right. They are arranged in the alphabetical order of the author names. ------------------------------------------------------------------------------ Aarestrup,F.M.Threlfall,E.J. -> AF393510 AF393510 Aarnikunnas,J. -> AY090766 AY090766 Aarnio,T. -> AY792975 AY792975 Aarnio,T. -> AY792976 AY792976 Aarnio,T. -> AY792977 AY792977 Aarnio,T. -> AY792978 AY792978 Aarnio,T. -> AY792979 AY792979 Aarnio,T. -> AY792980 AY792980 Aarnio,T. -> AY792981 AY792981 Aarnio,T. -> AY792982 AY792982 ------------------------------------------------------------------------------ 7.4. Part of the contents in the directory file 'ddbjbct1.dir' For each locus name given in the first column, the corresponding primary accession number, molecular type, number of nucleotide pairs, and description for the locus are respectively listed. They are arranged in the alphabetical order of the locus names. ------------------------------------------------------------------------------ AAC133631 AJ133631 DNA 1482 Alicyclobacillus acidoterrestris 16S rRNA gene, strain DSM 3922T. AAC133789 AJ133789 DNA 3097 Alicyclobacillus acidocaldarius cyclomaltodex trinase gene region. AAC243194 AJ243194 DNA 1720 Alicyclobacillus acidocaldarius kdpA gene. AAC252160 AJ252160 DNA 1638 Alicyclobacillus acidocaldarius cysA gene for putative ABC-transporter ATP-binding protein. AAC252161 AJ252161 DNA 8690 Alicyclobacillus acidocaldarius maltose/maltodextrine transport gene region (malEFGR genes, cdaA gene and glcA gene). AAC289685 AJ289685 DNA 453 Actinobacillus actinomycetemcomitans partial infB gene for translation initiation factor IF2, strain CCUG13227 T (ATCC33384, NCTC9710). AAC289686 AJ289686 DNA 453 Actinobacillus actinomycetemcomitans partial infB gene for translation initiation factor IF2, strain HK666. AAC289687 AJ289687 DNA 453 Actinobacillus actinomycetemcomitans partial infB gene for translation initiation factor IF2, strain HK1662. AAC289694 AJ289694 DNA 453 Actinobacillus actinomycetemcomitans partial infB gene for translation initiation factor IF2, strain HK1651. ------------------------------------------------------------------------------ 7.5. Part of the contents in the file 'ddbjbct1.idx' The first column refers to the locus name, second column to the starting site of the locus in byte, and third to its ending site in byte. They are arranged in the alphabetical order of the locus names. ------------------------------------------------------------------------------ %***************************** #AAC133631 1125664347 1125667802 #AAC133789 1125786300 1125794416 #AAC243194 1136871421 1136876093 #AAC252160 1146107711 1146112332 #AAC252161 1146112333 1146131350 #AAC289685 1155353186 1155356047 #AAC289686 1155356048 1155358781 #AAC289687 1155358782 1155361517 #AAC289694 1155377972 1155380768 #AAC308623 1167555889 1167560983 ------------------------------------------------------------------------------ 7.6. Part of the contents in the file 'ddbjbct1.jou' This gives information on the journal in which sequence data were published. ------------------------------------------------------------------------------ Yi Chuan Xue Bao 29 (12), 1111-1117 (2002) -> AY601668 AY601668 Yi Chuan Xue Bao 29 (12), 1111-1117 (2002) -> AY603420 AY603420 Yi Chuan Xue Bao 30 (4), 364-369 (2003) -> AF526379 AF526379 Yonsei Med. J. 39 (6), 520-525 (1998) -> AF373217 AF373217 Yonsei Med. J. 39 (6), 520-525 (1998) -> AF373218 AF373218 Z. Lebensm.-Unters. -Forsch., A Eur. Food Res. Technol. 209, 83-87(1999). -> ABA7623 AJ007623 Z. Lebensm.-Unters. -Forsch., A Eur. Food Res. Technol. 209, 83-87(1999). -> ABA7624 AJ007624 Zb. Bioteh. Fak. Univ. Ljubl. Kmet. Supl. 79(1), 107-113(2002). -> ASP012466 AJ012466 Zb. Bioteh. Fak. Univ. Ljubl. Kmet. Supl. 79(1), 19-26(2002). -> ASP012466 AJ012466 Zentralbl. Bakteriol. 286 (1), 1-8 (1997) -> AF192489 AF192489 Zentralbl. Bakteriol. 290, 37-49(2000). -> LPN7311 AJ007311 Zentralbl. Bakteriol. 291, 345-352(2001). -> LPN300467 AJ300467 Zentralbl. Bakteriol. 292, 207-214(2002). -> ECO459584 AJ459584 Zhi Wu Bao Hu Xue Hui Hui Kan 44, 233-244 (2002) -> AF540014 AF540014 Zhi Wu Bing Li Xue Bao 34 (1), 80-85 (2004) -> AY447045 AY447045 Zhi Wu Bing Li Xue Hui Kan 12, 57-64 (2003) -> AF450275 AF450275 Zhiwu Baohuxue Hui Huikan 44, 185-208 (2002) -> AY122057 AY122057 Zhiwu Binglixue Huikan 6, 207-208 (1997) -> AF149819 AF149819 Zhongguo Jiaqin 25 (Supplement 1), 60-71 (2003) -> AY615358 AY615358 Zhongguo Kang Sheng Su Za Zhi 21, 94-97 (2003) -> AY293073 AY293073 Zhongguo Kang Sheng Su Za Zhi 28, 96-100 (2003) -> AY293071 AY293071 Zhongguo Kang Sheng Su Za Zhi 28, 96-100 (2003) -> AY293072 AY293072 Zhongguo Lin Chuang Yao Li Xue Za Zhi 19, 190-195 (2003) -> AY536040 AY536040 Zhongguo Nong Ye Ke Xue 36(1), 17-25 (2003) -> AY555768 AY555768 Zhonghua Liu Xing Bing Xue Za Zhi 24, 291-295 (2003) -> AY279003 AY279003 Zhonghua Min Guo Wei Sheng Wu Ji Mian Yi Xue Za Zhi (2003) In press -> AY299484 AY299484 Zhonghua Min Guo Wei Sheng Wu Ji Mian Yi Xue Za Zhi 22 (5), 489-492 (2002) -> AY382160 AY382160 Zool. Sci. 14, 701-706 (1997) -> AB002286 AB002286 Zool. Sci. 14, 701-706 (1997) -> AB002287 AB002287 Zool. Sci. 14, 701-706 (1997) -> AB002288 AB002288 Zool. Sci. 14, 701-706 (1997) -> AB002289 AB002289 Zool. Sci. 14, 701-706 (1997) -> AB002290 AB002290 Zool. Sci. 14, 701-706 (1997) -> AB002291 AB002291 Zoolog. Sci. 17, 983-989 (2000) -> AB038366 AB038366 Zoolog. Sci. 17, 983-989 (2000) -> AB038367 AB038367 Zoolog. Sci. 17, 983-989 (2000) -> AB038368 AB038368 Zoolog. Sci. 17, 983-989 (2000) -> AB038369 AB038369 Zoolog. Sci. 17, 983-989 (2000) -> AB038370 AB038370 ------------------------------------------------------------------------------ 7.7. Part of the contents in the file 'ddbjbct1.key' For the locus and accession number respectively given on the right to the arrow, the corresponding keywords are listed on the left. ------------------------------------------------------------------------------ Synechococcus sp. DNA for intrinsic membrane protein, malK-like protein, cyanase, complete cds. -> AB000100 AB000100 cynS; cyanase; cynD; malK-like protein; cynB; intrinsic membrane protein. -> AB000100 AB000100 Direct Submission -> AB000100 AB000100 Identification and nitrogen regulation of the cyanase gene from the cyanobacteri a Synechocystis sp. strain PPC 6803 and Synechococcus sp. strain PPC 7942 -> AB000100 AB000100 Sequence updated (31-Mar-1997) by: Tatsuo Omata Sequence updated (14-Aug-1997) -> AB000100 AB000100 Sphingomonas sp. 16S ribosomal RNA. -> AB000106 AB000106 16S rRNA. -> AB000106 AB000106 Direct Submission -> AB000106 AB000106 Sphingomonas sp. VT1 16s rRNA -> AB000106 AB000106 Synechococcus sp. gene for ribosomal proteins, complete cds. -> AB000111 AB000111 tRNA pseudouridine synthase I; 50S ribosomal protein L17; DNA-dircted RNA polymerase alpha chain; 30S Ribosomal Protein S11; 30S ribosomal protein S13; 50S ribosomal protein L36; adenylate kinase; preprotein translocase SecY subunit; 50S ribosomal protein L15; 30S ribosomal protein S5; 50S ribosomal protein L18; 50S ribosomal protein L6; 30S ribosomal protein S8; 50S ribosomal protein L5; 50S ribosomal protein L24; 50S ribosomal protein L14; 30S ribosomal protein S17; 50S ribosomal protein L29; 50S ribosomal protein L16; 30S ribosomal protein S3; 50S ribosomal protein L22; 30S ribosomal protein S19; 50S ribosomal protein L2; 50S ribosomal protein L23; 50S ribosomal protein L4; 50S ribosomal protein L3. -> AB000111 AB000111 Direct Submission -> AB000111 AB000111 ------------------------------------------------------------------------------ 7.8. Part of the contents in the file 'ddbjbct1.org' For the locus and accession number respectively given on the right to the arrow, the corresponding taxonomic names are listed on the left. They are arranged in the alphabetical order of the species names. ------------------------------------------------------------------------------ 'Flavobacterium' lutescens 'Flavobacterium' lutescens Bacteria; Proteobacteria; gamma subdivision; Pseudomonadaceae; Pseudomonas. -> AB035478 AB035478 'Flavobacterium' lutescens 'Flavobacterium' lutescens Bacteria; Proteobacteria; gamma subdivision; Pseudomonadaceae; Pseudomonas. -> AB042983 AB042983 'Fragaria multicipita' phytoplasma 'Fragaria multicipita' phytoplasma Bacteria; Firmicutes; Mollicutes; Acholeplasmatales; Acholeplasmataceae; Candidatus Phytoplasma. -> AF036354 AF036354 'Fragaria multicipita' phytoplasma 'Fragaria multicipita' phytoplasma Bacteria; Firmicutes; Mollicutes; Acholeplasmatales; Acholeplasmataceae; Candidatus Phytoplasma. -> AF190224 AF190224 'Fragaria multicipita' phytoplasma 'Fragaria multicipita' phytoplasma Bacteria; Firmicutes; Mollicutes; Acholeplasmatales; Acholeplasmataceae; Candidatus Phytoplasma. -> AF190225 AF190225 'Helichrysum bracteatum' phytoplasma 'Helichrysum bracteatum' phytoplasma Bacteria; Firmicutes; Mollicutes; Acholeplasmatales; Acholeplasmataceae; Candidatus Phytoplasma. -> AF515771 AF515771 'Momordica charantia' phytoplasma 'Momordica charantia' phytoplasma Bacteria; Firmicutes; Mollicutes; Acholeplasmatales; Acholeplasmataceae; Candidatus Phytoplasma. -> PHY431368 AJ431368 'Rehmannia glutinosa var. purpurea' phytoplasma 'Rehmannia glutinosa var. purpurea' phytoplasma Bacteria; Firmicutes; Mollicutes; Acholeplasmatales; Acholeplasmataceae; Candidatus Phytoplasma. -> AF335107 AF335107 'Rhizomonas' sp. 'Rhizomonas' sp. Bacteria; Proteobacteria; Alphaproteobacteria; Sphingomonadales; Sphingomonadaceae; Sphingomonas. -> UBA132327 AJ132327 'Vinca minor' phytoplasma 'Vinca minor' phytoplasma Bacteria; Firmicutes; Mollicutes; Acholeplasmatales; Acholeplasmataceae; Candidatus Phytoplasma. -> AY144608 AY144608 ------------------------------------------------------------------------------ 7.9. Part of the contents in the short directory file 'ddbjbct1.sdr' The short directory file contains brief descriptions of all of the sequence entries contained in the DDBJ style. ------------------------------------------------------------------------------ AC133631 Alicyclobacillus acidoterrestris 16S rRNA gene, strain DSM 1482bp AAC133789 Alicyclobacillus acidocaldarius cyclomaltodextrinase gene 3097bp AAC243194 Alicyclobacillus acidocaldarius kdpA gene. 1720bp AAC252160 Alicyclobacillus acidocaldarius cysA gene for putative 1638bp AAC252161 Alicyclobacillus acidocaldarius maltose/maltodextrine 8690bp AAC289685 Actinobacillus actinomycetemcomitans partial infB gene for 453bp AAC289686 Actinobacillus actinomycetemcomitans partial infB gene for 453bp AAC289687 Actinobacillus actinomycetemcomitans partial infB gene for 453bp AAC289694 Actinobacillus actinomycetemcomitans partial infB gene for 453bp AAC308623 Alicyclobacillus acidocaldarius celA gene for cellulase. 1778bp AAC417690 Actinobacillus actinomycetemcomitans mukB gene. 4491bp AAC419840 Acetobacter aceti 16S rRNA gene, strain LMG 1531. 1440bp AAC430786 Actinobacillus actinomycetemcomitans partial fur gene for 1246bp AAC493667 Alicyclobacillus acidocaldarius subsp. rittmannii 16S rRNA 1472bp AAC496806 Alicyclobacillus acidocaldarius 16S rRNA gene, strain DSM 1507bp ------------------------------------------------------------------------------ In addition to the tables for the four following index files are included in this release. These files were prepared for BCT, ENV, EST, GSS, HTC, HTG, HUM, INV, MAM, PAT, PHG, PLN, PRI, ROD, STS, SYN, UNA, VRL, and VRT divisions. Accession number index file Keyword phrase index file Journal citation index file Gene name index file A brief description is given for each file in the above section, '3. Dataset categories'. 7.10. Part of the contents in the accession number index file 'ddbjacc1.idx' The following excerpt from the accession number index file illustrates the format of the index. ------------------------------------------------------------------------------ D00001 ECPBPA BCT X04516 D00002 ECPYRC BCT X04469 D00003 HUMP450M HUM D00003 D00004 FLBFLBL40 VRL D00004 D00005 IBAMEM682 VRL D00005 D00006 BACPNS1981 BCT D00006 D00007 CHKCALGRP VRT D00007 D00008 ECPNTAB BCT X04195 D00009 DROPER1 INV D00009 ------------------------------------------------------------------------------ 7.11. Part of the contents in the keyword phrase index file 'ddbjkey1.idx' Keyword phrases consist of names for gene products and other characteristics of sequence entries. ------------------------------------------------------------------------------ "COAT PROTEIN SMO511347 VRL AJ511347 'TNPA GENE UBA564903 BCT AJ564903 'ZINC-FINGER' MOTIF PRNS53 VRL X60546 (+) MATING TYPE SURFACE PROTEIN ABGPSSP PLN M94861 (1,3 TABETGLUB PLN Z22874 (1,3)-BETA-D-GLUCAN BINDING PROTEIN AJ606470 INV AJ606470 (1,3)BETA-GLUCAN SYNTHASE NCU09275 PLN U09275 (1,4)-BETA-D-ARABINOXYLAN ARABINOFURANOHYDROLASE ANAXHA PLN Z78011 ANTUAXHA PLN Z78010 (1,6)-BETA-GLUCAN BIOSYNTHESIS YSAKRE1A PLN M81588 (1-3)-BETA-GLUCANASE NTSP41AGN PLN X81560 PA13BGPT PLN X57794 (1-3,1-4)-BETA-D-GLUCANASE HVBDG PLN X52572 (1-4)-BETA-MANNAN ENDOHYDROLASE CAR278996 PLN AJ278996 CAR293305 PLN AJ293305 (2',5'-OLIGOISOADENYLATE SYNTHETASE-DEPENDENT) AL138776 HUM AL138776 (2'-5') OLIGO(A) SYNTHASE E16 SSO4G06 EST F14610 (2'-5')OLIGOADENYLATE SYNTHETASE HSA225089 HUM AJ225089 HUMSYN25A HUM D00068 SSA225090 MAM AJ225090 (6')-IB' AMINOGLYCOSIDE ACETYLTRANSFERASE AXY278514 BCT AJ278514 PAE291609 BCT AJ291609 (8,11)-LINOLEOYL DESATURASE COF245938 PLN AJ245938 ------------------------------------------------------------------------------ 7.12. Part of the contents in the journal citation index file 'ddbjjou1.idx' The journal citation index file lists all of the citations that appear in the references. ------------------------------------------------------------------------------ (ER) AAPS PHARMSCI. 4 (3), DOI 10.1208/PS040315 (2002) AY170916 ROD AY170916 (ER) AM. J. HUM. GENET. 76 (1) (2004) IN PRESS AY753209S1 HUM AY753209 AY753209S2 HUM AY753210 (ER) ARCH. VIROL. (2004) IN PRESS AF531505 VRL AF531505 AY518899 VRL AY518899 AY518900 VRL AY518900 AY518901 VRL AY518901 AY518902 VRL AY518902 AY518903 VRL AY518903 AY518904 VRL AY518904 AY518905 VRL AY518905 AY518906 VRL AY518906 AY518907 VRL AY518907 AY518908 VRL AY518908 AY518909 VRL AY518909 AY518910 VRL AY518910 AY518911 VRL AY518911 AY518912 VRL AY518912 AY518913 VRL AY518913 AY518914 VRL AY518914 AY518915 VRL AY518915 AY518916 VRL AY518916 AY518917 VRL AY518917 AY518918 VRL AY518918 AY518919 VRL AY518919 AY518920 VRL AY518920 AY518921 VRL AY518921 AY518922 VRL AY518922 AY518923 VRL AY518923 AY518924 VRL AY518924 AY518925 VRL AY518925 AY518926 VRL AY518926 AY518927 VRL AY518927 AY518928 VRL AY518928 AY518929 VRL AY518929 AY518930 VRL AY518930 AY518931 VRL AY518931 AY518932 VRL AY518932 AY521234 VRL AY521234 AY521235 VRL AY521235 AY521236 VRL AY521236 AY521237 VRL AY521237 AY521238 VRL AY521238 (ER) ARTERIOSCLER. THROMB. VASC. BIOL. (2004) IN PRESS AY563557 HUM AY563557 (ER) BIOCHEM. BIOPHYS. RES. COMMUN. 325 (1), 203-214 (2004) AY563137 HUM AY563137 (ER) BIOCHEM. J./10.1042/BJ20030293 HSA496460 HUM AJ496460 ------------------------------------------------------------------------------ 7.13. Part of the contents in the gene name index file 'ddbjgen.idx' This file lists all the gene names that appear in the feature table. ------------------------------------------------------------------------------ 'ARR BX927156 BCT BX927156 'BGLG BX927156 BCT BX927156 'BGLS BX927148 BCT BX927148 'BGLY' BX927156 BCT BX927156 'BRNQ AF305888 BCT AF305888 'COMK AL591983 BCT AL591983 AL596172 BCT AL596172 'CRCB BX927155 BCT BX927155 'CRTI BX927155 BCT BX927155 'DPPE LDDIPEP BCT Z34898 'FIC BX936398 BCT BX936398 ------------------------------------------------------------------------------ 8. Release history Release Date Entries Bases Comments 68 12/06 64,267,978 68,259,314,742 1.5 GB storage started 67 09/06 61,144,621 65,443,024,193 66 06/06 58,176,628 62,945,843,881 65 03/06 55,890,995 60,564,721,635 TPA subcategories started 64 12/05 52,272,669 56,098,558,378 Some index files split 63 09/05 47,741,593 52,246,110,341 62 06/05 45,249,444 49,158,155,283 ENV started Version for release note started 61 03/05 43,118,204 47,099,081,750 Changed style of release note 60 12/04 40,583,945 44,416,752,273 /db_xref="H-inv:**" started 59 09/04 37,926,117 42,245,956,937 58 06/04 34,917,581 39,812,635,108 57 03/04 32,693,678 38,008,449,840 56 12/03 30,405,173 36,079,046,032 55 09/03 27,753,140 34,280,225,489 54 06/03 25,149,821 32,162,041,177 53 02/03 23,250,813 29,711,299,332 52 12/02 20,354,812 26,931,456,316 51 09/02 18,401,358 22,782,404,136 TPA started 50 06/02 17,260,693 20,158,357,982 49 04/02 16,503,157 18,579,627,226 48 01/02 15,016,100 16,197,713,855 47 10/01 13,266,610 14,145,671,645 46 07/01 12,313,759 13,037,646,166 45 04/01 11,434,113 12,207,092,905 HTC division started 44 01/01 10,165,597 11,136,298,841 43 10/00 8,666,551 10,034,532,698 42 07/00 7,554,995 8,880,721,093 41 04/00 5,962,608 6,409,581,885 CON division started 40 01/00 5,388,125 4,762,696,173 RNA division terminated 39 10/99 4,810,773 3,728,000,562 NID and PID discarded 38 07/99 4,294,369 3,098,519,597 37 03/99 3,311,627 2,375,261,951 VERSION, /protein_id started 36 01/99 3,073,166 2,190,425,560 35 10/98 2,759,261 1,957,341,169 34 07/98 2,412,785 1,708,580,623 33 04/98 2,174,769 1,479,303,279 32 01/98 1,956,669 1,300,950,613 31 10/97 1,731,532 1,139,869,464 Adoption of the unified taxonomy database 30 07/97 1,534,115 992,788,339 NID and PID terminated 29 04/97 1,270,194 841,415,232 28 01/97 1,154,120 756,785,219 HTG division started ORG division terminated 27 10/96 936,697 608,103,057 GSS division started 26 07/96 835,552 551,932,448 25 04/96 744,490 499,300,364 /translation started 24 01/96 637,508 431,771,652 23 10/95 569,757 390,694,350 22 07/95 437,588 322,982,425 HUM division started 21 04/95 274,596 250,875,023 20 01/95 239,689 231,299,557 19 10/94 204,332 205,274,131 18 07/94 185,230 192,473,021 17 04/94 169,957 179,942,209 16 01/94 154,626 165,017,628 15 10/93 131,649 147,224,690 14 07/93 120,350 138,686,333 13 04/93 112,067 129,784,445 12 01/93 97,683 120,815,244 EST division started 11 07/92 65,693 84,839,075 10 01/92 59,317 77,805,556 GenBank/EMBL inclusion started 9 07/91 1,130 2,002,124 8 01/91 879 1,573,442 7 07/90 681 1,154,211 6 01/90 496 841,236 5 07/89 395 679,378 4 01/89 302 535,985 3 07/88 230 345,850 2 01/88 142 199,392 1 07/87 66 108,970 Started with DDBJ only ------------------ Since release 65 ------------------ Introduction of two types of TPA entries: According to the decision of ICM 2005, TPA data set is now classified into two categories, "TPA:experimental" and "TPA:inferential", to distinguish TPA annotation supported by wet-lab. experimental evidence and that inferred. The retrofit to divide TPA entries into two categories starts from the release 65. You can find the description of the two TPA categories at the following URLs; http://www.ddbj.nig.ac.jp/sub/tpa-e.html http://www.insdc.org/TPA.html See also '3.2. TPA separated from primary dataset'. ------------------ Since release 64 ------------------ Split of index files: In the present release, some of index files (ddbjacc.idx, ddbjjou.idx, and ddbjkey.idx) have been greater than 2 GB in the file size. So, these have been recorded in multiple ddbj****.idx files, each of which at most has 1.5 GB storage capacity as follows, respectively. See also 6.2., 7.10., 7.11., 7.12. and 9. ------------------ Since release 62 ------------------ Release version number is introduced: DDBJ has started to include the item, 'version', for its release note, which indicates a version for its periodical release. It is expressed like '62.0', in which the digit(s) after the period is a version number. The reason for adding the version number is that a released data is sometimes revised due to urgent and necessary corrections. The number is increased by one every time when a revised periodical release is made public until the next release. Introduction of ENV division: Recently, the submissions of the sequences derived from environmental samples have rapidly increased. To accommodate such submissions, a new division, ENV, has been created (See also '3.1. Division categories'). This division contains the sequences obtained via direct molecular isolation such as PCR, DGGE, or any anonymous method. In the past, the sequences derived from environmental samples belonged to taxonomic divisions, mainly BCT. At DDBJ, the retrofit to transfer relevant entries from taxonomic divisions to the ENV division starts in the present release, and ends by the next periodical release. Please note that during this transitional period, some entries to be eventually placed in the ENV division will be found in other divisions. Strand information is removed: The strand information of LOCUS line in the flat file has been removed as shown below. See also '2.1. LOCUS line'. ---------------------------------------------------------------------------- Old (-rel. 61): 44-44 space 45-47 spaces, ss- (single-stranded), ds- (double-stranded), or ms- (mixed-stranded) New (rel. 62-): 44-47 spaces ---------------------------------------------------------------------------- ------------------ Since release 61 ------------------ The style of release note (this file) has been changed. Some entries have the sequential format for the secondary accession numbers in the ACCESSION line, in order to make the expression of secondary accession numbers in the past short. For example; ------------------------------------------------------------------------------ Before; ACCESSION AB000802 D85885 D85886 D85887 After; ACCESSION AB000802 D85885-D85887 ------------------------------------------------------------------------------ See also '2.3. ACCESSION line'. ------------------ Since release 60 ------------------ The cross-reference to the H-invitational has been included. ------------------ Since release 56 ------------------ The three data banks have agreed that the maximum length limitation (350 kb) of a submitted sequence be relaxed. The BASE COUNT line of the DDBJ flat file format has been changed, corresponding to the relaxation of the maximum sequence length restriction in the entry that had been practiced at DDBJ/EMBL/GenBank International Nucleotide Sequence Databases. In the BASE COUNT line of the DDBJ flat file, 6 digits had been allocated for each number of a, c, g, t and other bases in the sequence. Hereafter, in the new flat file format, 9 digits are allocated for each number of a, c, g and t, while the numbers of other bases are removed. In accordance with the relaxation of sequence length limitation, GenBank had already dropped the BASE COUNT line from their flat file format from GenBank Release 138 (Oct. 2003). We DDBJ have decided to maintain the BASE COUNT line in our flat file format from the view that GC contents are still important information to characterize the sequence. The changes in the BASE COUNT line are shown below. ---------------------------------------------------------------------------- Old (-rel. 55): 1 6 11 16 21 26 31 36 41 46 51 56 61 66 71 |----|----|----|----|----|----|----|----|----|----|----|----|----|----| BASE COUNT 123456 a 123456 c 123456 g 123456 t 123456 others New (rel. 56-): 1 6 11 16 21 26 31 36 41 46 51 56 61 66 71 |----|----|----|----|----|----|----|----|----|----|----|----|----|----| BASE COUNT 123456789 a 123456789 c 123456789 g 123456789 t ---------------------------------------------------------------------------- The SOURCE in the flat file is revisited and revised if necessary in accordance with the unified taxonomy database common to the three data banks. ------------------ Since release 54 ------------------ '/sequenced_mol' qualifier has been changed to '/mol_type' qualifier. We accordingly completed retrofitting the pertinent entries. This change was made on the agreement at the INSD collaborative meeting in 2002. ------------------ Since release 51 ------------------ The TPA (Third Party Annotation) dataset has been available. The dataset is a complement to the existing DDBJ/EMBL/GenBank database of the primary nucleotide sequences which were obtained from direct sequencing of cDNAs, ESTs, genomic DNAs etc. The format of LOCUS line in the flat file has been changed as shown below to adjust to the GenBank format. ------------------------------------------------------------------------------ Old (-rel. 50): LOCUS AB000001 660 bp DNA PLN 01-FEB-2001 New (rel. 51-): LOCUS AB000001 660 bp DNA linear PLN 01-FEB-2001 ------------------------------------------------------------------------------ ------------------ Since release 45 ------------------ The HTC (High Throughput cDNA) division has been included. This is to include unfinished high throughput cDNA sequences, each of which has 5'UTR and 3'UTR at both ends and part of a coding region. The sequence may also include introns. When the sequence becomes finished later, it moves to the corresponding taxonomic division. The sequence is accompanied with a keyword, HTC (High Throughput cDNA), which is dropped when the sequence is finished and moved to a taxonomic division. ------------------ Since release 41 ------------------ The CON division has been included. This division is to show the order of related sequences in a genome, and expressed by join and the accession numbers of the sequences. The contents of the CON division are compiled by the three data banks not by the data submitter. ------------------ Since release 40 ------------------ The RNA division was terminated. The RNA data have been redistributed according to the category of the organism. Therefore, you will find a human RNA sequence, for example, in the HUM division. ------------------ Since release 37 ------------------ The three data banks include the item VERSION in the flat file, which indicates a version of a submitted nucleotide sequence. It is expressed like AB123456.1, in which the digit(s) after the period is a version number. The reason for adding VERSION is that since a released sequence sometimes revised by the submitter, the accession number alone cannot specify the sequence in question causing the user a trouble. The number is increased by one every time when a revised sequence is made public. Accordingly, the translated protein sequence will be accompanied with a /protein_id which is expressed as BAA12345.1, in which the digit(s) after the period is again a version number. The number is increased by one when the corresponding nucleotide sequence is revised and the protein sequence is changed as a result, and when the revised protein sequence is made public. ------------------ Since release 31 ------------------ We have started adopting the unified taxonomy database to unify the biological source of the sequence. The database is made up with scientific names, ID of unidentified organisms, and synthetic constructs etc. ------------------ Since release 30 ------------------ NID and PID were terminated. This change was made on the agreement at the INSD collaborative meeting in 1999. ------------------ Since release 28 ------------------ The HTG (High Throughput Genomic sequence) has been included. This division was created to cope with genome project teams which deal with a clone as a sequencing unit. We terminated the ORG (Organelle) division. Thus, if you are interested in human mitochondrial sequences, for example, you are now advised to refer to the HUM division. ------------------ Since release 27 ------------------ The GSS division has been included. GSS stands for Genome Survey Sequence, which is similar to EST, except that GSS is genomic DNA whereas EST is cDNA. ------------------ Since release 25 ------------------ DDBJ release contains amino acid sequences that were translated from the corresponding nucleotide sequences of the database. In the translation we paid much attention to the fact that some species or organella have a codon different from the universal one, and used the proper codon table. ------------------ Since release 22 ------------------ The HUM division has been included. Human genome projects have probably been most productive and yielded a large number of sequences Thus, we have the human (HUM) division solely for human sequences and the primate (PRI) division for non-human primate sequences. ------------------ Since release 12 ------------------ The EST (Expressed Sequence Tag) division has been included. The number of ESTs has been increasing at an enormous rate and is expected to be growing even more rapidly in the future. Thus, we created a division for ESTs ------------------ Since release 10 ------------------ The sequences submitted to GenBank or EMBL have been included in the release. 9. File list The files in this release are arranged in the following order with non-labeled format. ----------------------------------------------------------------------- file name file size ----------------------------------------------------------------------- ddbjrel.txt (DDBJ release note) 73616 ddbjacc1.idx (Accession number index file 1) 1499999975 ddbjacc2.idx (Accession number index file 2) 1006572490 ddbjgen.idx (Gene name index file) 95919506 ddbjjou1.idx (Journal citation index file 1) 1475840424 ddbjjou2.idx (Journal citation index file 2) 1342187637 ddbjkey1.idx (Keyword phrase index file 1) 1457299971 ddbjkey2.idx (Keyword phrase index file 2) 1278002134 ----------------------------------------------------------------------- file name number of entries number of bases file size ----------------------------------------------------------------------- ddbjbct1.seq 113906 613815004 1499254636 ddbjbct2.seq 69992 644624868 1500847262 ddbjbct3.seq 90665 567505969 1344660578 ddbjenv.seq 301753 251604912 832527035 ddbjest1.seq 462736 173138265 1499000639 ddbjest2.seq 490838 192015413 1499000123 ddbjest3.seq 498435 206118293 1499000742 ddbjest4.seq 480612 204949045 1499000198 ddbjest5.seq 543164 300931329 1499000526 ddbjest6.seq 575203 336245600 1499000144 ddbjest7.seq 482440 188254777 1499003351 ddbjest8.seq 386884 146406598 1499002175 ddbjest9.seq 521407 249511256 1499000417 ddbjest10.seq 469594 200112602 1499001372 ddbjest11.seq 401898 151700752 1499004389 ddbjest12.seq 266438 82081835 1499000877 ddbjest13.seq 267416 92295017 1499000215 ddbjest14.seq 322222 158497578 1499000266 ddbjest15.seq 481538 232006424 1499000325 ddbjest16.seq 468198 253751163 1499002749 ddbjest17.seq 457188 249019545 1499001091 ddbjest18.seq 454646 226987544 1499000656 ddbjest19.seq 466735 255683560 1499003106 ddbjest20.seq 465235 295612127 1499000518 ddbjest21.seq 476083 250326477 1499002818 ddbjest22.seq 446696 261095086 1499001134 ddbjest23.seq 479030 268022499 1499000911 ddbjest24.seq 571969 324899809 1499002513 ddbjest25.seq 448376 237543409 1499002272 ddbjest26.seq 434337 254888797 1499002814 ddbjest27.seq 460090 256987878 1499001094 ddbjest28.seq 487354 254027867 1499000296 ddbjest29.seq 472757 243478318 1499003782 ddbjest30.seq 456856 243823647 1499000891 ddbjest31.seq 443246 278978137 1499000397 ddbjest32.seq 424415 320176634 1499000421 ddbjest33.seq 448657 265603979 1499001739 ddbjest34.seq 648804 378434422 1499001926 ddbjest35.seq 490945 296849437 1499002440 ddbjest36.seq 440320 281457144 1499000666 ddbjest37.seq 251908 95023619 1499000508 ddbjest38.seq 252664 99334738 1499004610 ddbjest39.seq 256185 121511128 1499000478 ddbjest40.seq 483622 265922575 1499000165 ddbjest41.seq 479813 267206801 1499001598 ddbjest42.seq 448549 239340989 1499002311 ddbjest43.seq 474693 282063487 1499000736 ddbjest44.seq 520131 261513967 1499003215 ddbjest45.seq 434789 258018648 1499001803 ddbjest46.seq 556105 281996017 1499000849 ddbjest47.seq 430913 247974799 1499001763 ddbjest48.seq 405632 238575402 1499001039 ddbjest49.seq 255434 130985262 1499005162 ddbjest50.seq 260702 107033893 1499001035 ddbjest51.seq 293096 127805728 1499000681 ddbjest52.seq 393311 213917261 1499000903 ddbjest53.seq 508754 319896824 1499002897 ddbjest54.seq 444265 267859745 1499000239 ddbjest55.seq 441199 250164653 1499001349 ddbjest56.seq 468665 271212081 1499003422 ddbjest57.seq 458779 256787979 1499000420 ddbjest58.seq 432470 252859730 1499000283 ddbjest59.seq 455600 263079364 1499007496 ddbjest60.seq 471666 281041990 1499002164 ddbjest61.seq 442836 248404182 1499002839 ddbjest62.seq 446000 262333408 1499001904 ddbjest63.seq 464945 277783889 1499004140 ddbjest64.seq 391424 256980929 1499003227 ddbjest65.seq 405674 251624299 1499002075 ddbjest66.seq 423459 234388619 1499000010 ddbjest67.seq 419789 235158388 1499003117 ddbjest68.seq 428225 233528916 1499001975 ddbjest69.seq 447603 249519400 1499001236 ddbjest70.seq 461355 284037378 1499000652 ddbjest71.seq 400361 305319803 1499001153 ddbjest72.seq 505264 292873667 1499000062 ddbjest73.seq 397003 284305771 1499002741 ddbjest74.seq 378978 253371799 1499003612 ddbjest75.seq 379938 270538011 1499002967 ddbjest76.seq 421465 303813311 1499001665 ddbjest77.seq 439182 314333567 1499001904 ddbjest78.seq 470934 317548635 1499002725 ddbjest79.seq 497638 292009241 1499001148 ddbjest80.seq 547375 220673295 1499001478 ddbjest81.seq 537891 298529082 1499001657 ddbjest82.seq 476630 325609127 1499000528 ddbjest83.seq 499995 313596566 1499002144 ddbjest84.seq 682606 334242185 1499002177 ddbjest85.seq 574628 253103128 1499003414 ddbjest86.seq 451901 309200538 1499000590 ddbjest87.seq 549460 327664297 1499001627 ddbjest88.seq 516121 257396156 1499000881 ddbjest89.seq 317812 117096070 1003276855 ddbjgss1.seq 474285 342611936 1499000786 ddbjgss2.seq 468898 329158127 1499000121 ddbjgss3.seq 456945 304886961 1499001385 ddbjgss4.seq 520877 255173482 1499001819 ddbjgss5.seq 469191 261074836 1499002443 ddbjgss6.seq 426557 213018971 1499001604 ddbjgss7.seq 400705 201027532 1499002908 ddbjgss8.seq 455715 245042614 1499000920 ddbjgss9.seq 535991 304982733 1499000393 ddbjgss10.seq 535389 314486702 1499002971 ddbjgss11.seq 511140 328907205 1499001808 ddbjgss12.seq 541420 310948425 1499001660 ddbjgss13.seq 490438 387572234 1499003024 ddbjgss14.seq 578047 367623084 1499002212 ddbjgss15.seq 646933 336443958 1499001484 ddbjgss16.seq 572012 396971674 1499000985 ddbjgss17.seq 539773 325021235 1499002818 ddbjgss18.seq 514936 345672459 1499001809 ddbjgss19.seq 576721 387030330 1499000154 ddbjgss20.seq 593662 388717813 1499000971 ddbjgss21.seq 585490 394627383 1499001844 ddbjgss22.seq 477977 290194297 1499001767 ddbjgss23.seq 530661 346559434 1499000828 ddbjgss24.seq 530695 338384275 1499000879 ddbjgss25.seq 535504 340808640 1499001048 ddbjgss26.seq 505645 362094775 1499000364 ddbjgss27.seq 492282 366722047 1499002260 ddbjgss28.seq 536977 368955265 1499002027 ddbjgss29.seq 561955 344819471 1499002603 ddbjgss30.seq 467860 358255457 1499002731 ddbjgss31.seq 498072 328918299 1365107611 ddbjhtc1.seq 275809 360315628 1499000447 ddbjhtc2.seq 175137 193933256 678537515 ddbjhtg1.seq 11401 1118293750 1499071765 ddbjhtg2.seq 7499 1118504003 1499159757 ddbjhtg3.seq 5877 1131171118 1499195998 ddbjhtg4.seq 5473 1140175951 1499315405 ddbjhtg5.seq 5292 1144503113 1499250139 ddbjhtg6.seq 5294 1144970551 1499098536 ddbjhtg7.seq 6535 1132547113 1499036338 ddbjhtg8.seq 6900 1141380654 1499249101 ddbjhtg9.seq 5891 1136472078 1499020479 ddbjhtg10.seq 6145 1129687984 1499159278 ddbjhtg11.seq 6461 1127976819 1499058397 ddbjhtg12.seq 7650 1114626972 1499036926 ddbjhtg13.seq 6982 1149083240 1499035900 ddbjhtg14.seq 6667 1133213913 1499404782 ddbjhtg15.seq 3035 489021945 634994780 ddbjhum1.seq 23224 1057599500 1499107772 ddbjhum2.seq 8158 1069823798 1499127669 ddbjhum3.seq 129840 866243851 1499169890 ddbjhum4.seq 70389 973763791 1499004792 ddbjhum5.seq 171294 332813670 891383822 ddbjinv1.seq 254336 691111474 1499003301 ddbjinv2.seq 160908 233429068 666332313 ddbjmam.seq 112635 254656688 569122953 ddbjpat1.seq 1035157 519908226 1499000992 ddbjpat2.seq 776426 493870324 1499002086 ddbjpat3.seq 746764 346529654 1499001101 ddbjpat4.seq 664126 580903979 1499008465 ddbjpat5.seq 332386 190652453 679457907 ddbjphg.seq 3262 21853290 53859827 ddbjpln1.seq 230797 721570931 1499001002 ddbjpln2.seq 65457 835599741 1535018936 ddbjpln3.seq 333562 568937383 1499000001 ddbjpln4.seq 109443 104242207 351988452 ddbjpri.seq 48538 598548628 871294450 ddbjrod1.seq 15218 1043480010 1499121118 ddbjrod2.seq 5924 1095330999 1499133939 ddbjrod3.seq 41108 1055011405 1499111070 ddbjrod4.seq 215655 797921640 1499006540 ddbjrod5.seq 36170 42612118 131743503 ddbjsts1.seq 419181 209389446 1499002381 ddbjsts2.seq 341318 239715208 1499001673 ddbjsts3.seq 130200 51388020 366993187 ddbjsyn.seq 42047 56803903 186576344 ddbjuna.seq 212 114823 435698 ddbjvrl1.seq 404761 407555375 1499000159 ddbjvrl2.seq 4946 2729993 13784922 ddbjvrt1.seq 220278 740043325 1499004521 ddbjvrt2.seq 108942 946996726 1437993766 ------------------------------------------------------------------------------ Total 64267978 68259314742 244466291465 ddbjcon1.seq 603890 0 1499000223 ddbjcon2.seq 266719 0 976491497 ddbjtpa.seq 5161 19444146 41236744 The entries and bases in the CON division and TPA dataset are not counted in the numbers given on the top of the release note or 'Total' on the above table.