DNA Data Bank of Japan DNA Database Release 72.0, Dec. 2007, including 79,004,098 entries, 82,592,245,487 bases ------------------------------------------------------------------------------- Table of contents ------------------------------------------------------------------------------- 1. Introduction 1.1. Announcement for changes in the present release 1.2. Announcement for the forthcoming changes 2. DDBJ flat file format 2.1. LOCUS line 2.2. DEFINITION line 2.3. ACCESSION line 2.4. VERSION line 2.5. KEYWORDS line 2.6. SOURCE line 2.7. REFERENCE line 2.8. COMMENT line 2.9. FEATURES line 2.10. BASE COUNT line 2.11. ORIGIN line 3. Dataset categories 3.1. Division categories 3.2. TPA separated from primary dataset 3.3. Notice for patented data 4. DDBJ staff 5. Acknowledgment 6. File categories 7. Sample of the contents in each file 7.1. Part of the contents in the file 'ddbjbct1.seq' 7.2. Part of the contents in the accession number index file 'ddbjacc1.idx' 7.3. Part of the contents in the keyword phrase index file 'ddbjkey1.idx' 7.4. Part of the contents in the journal citation index file 'ddbjjou1.idx' 7.5. Part of the contents in the gene name index 'ddbjgen.idx' 8. Release history 9. File list ------------------------------------------------------------------------------- 1. Introduction This database contains nucleotide sequence data for any organism, not only those with DNA genomes but also those with RNA genomes. This database may be copied and redistributed without permission on the condition that all the statements in this release note are reproduced in each copy. See also '3.3. Notice for patented data' below. The present release contains the newest data prepared by the DNA Data Bank of Japan (DDBJ), GenBank (*), and European Molecular Biology Laboratory/European Bioinformatics Institute (EMBL/EBI) as of Nov 22, 2007. This unified database was made possible thanks to the international collaboration among the three data banks. All the entries have accordingly been annotated using the feature keys common to them. *'GenBank' is a trademark of NIH, USA, and is operated by National Center for Biotechnology Information (NCBI) at NIH. 1.1. Announcement for changes in the present release Deletion of E-mail address, phone and fax numbers from DDBJ flat file: To follow the Japanese law of protecting personal information, DDBJ deleted both phone and fax numbers, and E-mail address from the flat files of the entries submitted to DDBJ. It would be also helpful to protect DDBJ releases against SPAM mail senders. DDBJ retrofitted most of all entries submitted to DDBJ, not to GenBank or EMBL, by the present release. In previous releases, the submitter information was described in JOURNAL line at REFERENCE 1 as, -------------------------------------------------------------------------------- REFERENCE 1 (bases 1 to 1200) AUTHORS Mishima,T. TITLE Direct Submission JOURNAL Submitted (01-Jan-1990) to the DDBJ/EMBL/GenBank databases. Taro Mishima, DNA Data Bank of Japan, National Institute of Genetics; 1111, Yata, Mishima, Shizuoka 411-8540, Japan (E-mail:ddbj@ddbj.nig.ac.jp, URL:http://www.ddbj.nig.ac.jp/, Tel:81-12-345-6789, Fax:81-12-345-9876) -------------------------------------------------------------------------------- After the deletion or the information in question, DDBJ flat file is either one of the following two types; Type 1: Phone and fax numbers and E-mail address are deleted. -------------------------------------------------------------------------------- REFERENCE 1 (bases 1 to 1200) AUTHORS Mishima,T. TITLE Direct Submission JOURNAL Submitted (01-Jan-1990) to the DDBJ/EMBL/GenBank databases. Contact:Taro Mishima DNA Data Bank of Japan, National Institute of Genetics; 1111, Yata, Mishima, Shizuoka 411-8540, Japan URL :http://www.ddbj.nig.ac.jp/ ------------------------------------------------------------------------------- Type 2: When the submitters wish to keep their contact information disclosed, it is described as, ------------------------------------------------------------------------------- REFERENCE 1 (bases 1 to 1200) AUTHORS Mishima,T. TITLE Direct Submission JOURNAL Submitted (01-Jan-1990) to the DDBJ/EMBL/GenBank databases. Contact:Taro Mishima DNA Data Bank of Japan, National Institute of Genetics; 1111, Yata, Mishima, Shizuoka 411-8540, Japan URL :http://www.ddbj.nig.ac.jp/ E-mail :ddbj@ddbj.nig.ac.jp Phone :81-12-345-6789 Fax :81-12-345-9876 ------------------------------------------------------------------------------- Revision of the DDBJ/EMBL/GenBank Feature Table: Definition: Following the agreement at the INSD collaborative meeting in 2007, the document, DDBJ/EMBL/GenBank Feature Table: Definition, was revised in October, 2007. See also '2.9. FEATURES line' below. The revised points are introduced on following URL; http://www.ddbj.nig.ac.jp/insdc/icm2007-e.html#ft 1.2. Announcement for the forthcoming changes Nothing particular. 2. DDBJ flat file format The database is a collection of "entry" which is the unit of the data. The entries submitted to databanks were processed and publicized according to the DDBJ format for distribution (flat file). The flat file includes the sequence and the information of submitters, references, source organisms, and "feature" information, etc. The items of the DDBJ flat file are explained at following; ------------------------------------------------------------------------------- LOCUS AB000000 450 bp mRNA linear HUM 08-JUL-2002 DEFINITION Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds. ACCESSION AB000000 VERSION AB000000.1 KEYWORDS . SOURCE Homo sapiens ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 450) AUTHORS Mishima,H. and Shizuoka,T. TITLE Direct Submission JOURNAL Submitted (30-NOV-2000) to the DDBJ/EMBL/GenBank databases. Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; 1111, Yata, Mishima, Shizuoka 411-8540, Japan REFERENCE 2 (sites) AUTHORS Mishima,H., Shizuoka,T. and Fuji,I. TITLE Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver JOURNAL Unpublished (2002) COMMENT Human cDNA sequencing project. FEATURES Location/Qualifiers source 1..450 /chromosome="12" /clone="GT200015" /clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)" /map="12p13" /mol_type="mRNA" /organism="Homo sapiens" /tissue_type="liver" CDS 86..>450 /codon_start=1 /gene="GAPD" /product="glyceraldehyde-3-phosphate dehydrogenase" /protein_id="BAA12345.1" /transl_table=1 /translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV" BASE COUNT 102 a 119 c 131 g 98 t ORIGIN 1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct 61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg 121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc 181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt 241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg 301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac 361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc 421 tcaacttaag ggtggtgcta agaaggtctg // ------------------------------------------------------------------------------- 2.1. LOCUS line The format of LOCUS line in the flat file is shown below; --------- -------- Positions Contents --------- -------- 01-05 'LOCUS' 06-12 spaces 13-28 Locus name 29-29 space 30-40 Length of sequence, right-justified 41-41 space 42-43 'bp' 44-47 spaces 48-54 DNA, RNA, mRNA, pre-RNA, rRNA, scRNA, snRNA, snoRNA, tRNA, left justified 55-55 space 56-63 'linear' followed by two spaces, or 'circular' 64-64 space 65-67 The division code (see '3.1. Division categories') 68-68 space 69-79 Date, in the form dd-MMM-yyyy (e.g., 08-JUL-2002) ------------------------------------------------------------------------------ 2.2. DEFINITION line The definition briefly describes the information of gene(s). "DEFINITION" is constructed by each of the three data banks. 2.3. ACCESSION line This line shows accession number of the entry data. A unique accession number is issued to the data submitter by each of the three data banks. The accession number is composed of 1 alphabet character and 5 digits (ex. A12345) or 2 alphabet characters and 6 digits (ex. AB123456). The former style was used in 1980s, but later the latter style was introduced because of data explosion. All the entries designated by the accession numbers with the prefixes given below have been collected and processed by DDBJ, and the rest have been done by GenBank and EMBL/EBI. ------------------------------------------------------------------------------- C, D, E, AB, AG, AK, AP, AT, AU, AV, BA, BB, BD, BJ, BP, BR, BS, BW, BY, CI, CJ, DA, DB, DC, DD, DE, DF, DG, DH, DJ ------------------------------------------------------------------------------- You can find the list of the prefixes of the accession numbers at the following URL; http://www.ddbj.nig.ac.jp/sub/prefix.html If multiple entries are united to an entry, or if an entry is extensively modified after the submission, the responsible data banks may assign a new accession number to it. In these cases, the new accession number is called the primary accession number, and the old accession number(s) is/are called the secondary accession number(s). In the flat file, the primary accession number is indicated first, then the secondary accession number(s) follows. You can find the same updated entry with both the primary and the secondary accession numbers. 2.4. VERSION line This line consists of an accession number and a version number, like "AB123456.1", in which the digit(s) after the period is a version number. The data open to public for the first time is version number as "1". The reason for adding VERSION is that since a released sequence sometimes revised by the submitter, the accession number alone cannot specify the sequence in question causing the user a trouble. The number is increased by one every time when a revised sequence is made public. 2.5. KEYWORDS line The data banks describe this line, if necessary. In many cases, the categories of the data (EST, HTG etc.), gene names and product names included in "KEYWORDS". 2.6. SOURCE line This line shows the scientific name on organism from which the sequence is obtained and an organelle type if the sequence is derived from an organelle other than the nucleus. 2.7. REFERENCE line The information on the submitters and references related to the submitted sequence is indicated in REFERENCE line. 2.8. COMMENT line. The information about an entry that can not be described using FEATURES or the other fields. 2.9. FEATURES line Biological features of a submitted sequence data are described with "Feature" key (the biological nature of the annotated feature), "Location" (the region of the sequence which corresponds to Feature), and "Qualifier" (supplementary information about Feature). The "Feature" and "Qualifier" keys used in the present release is defined by DDBJ/EMBL/GenBank Feature Table: Definition (Version 7.0 October, 2007). The document is continuously updated every half year. You can find its newest version on URL; http://www.ddbj.nig.ac.jp/FT/full_index.html 2.10. BASE COUNT line In the BASE COUNT line of the DDBJ flat file, 9 digits are allocated for each number of a (adenine), c (cytosine), g(guanine) and t (thymine). In the case of RNA sequence, uracil is indicated as "t" according to the rule of the international nucleotide database. In accordance with the relaxation of sequence length limitation, GenBank had already dropped the BASE COUNT line from their flat file format from GenBank Release 138 (Oct. 2003). DDBJ has decided to maintain the BASE COUNT line in our flat file format from the view that GC contents are still important information to characterize the sequence. 2.11. ORIGIN line The sequence data starts from the next line of ORIGIN. The sequence is indicated as lower case letters, delimited by space per 10 bases, starts a new line by 60 bases. The numbers described at left side of lines mean the ordinal number of the top base of the line. 3. Dataset categories There have been a number of genome projects going on worldwide. Among them human genome projects have probably been most productive and yielded a large number of ordinary sequences, huge amounts of genome sequences and EST (expressed sequence tags). Thus, we DDBJ have the human (HUM) division solely for human sequences and the primate (PRI) division for non-human primate sequences, while PRI division of GenBank database contains human sequences too. Note that the other divisions such as EST, GSS, and HTC may also contain human sequences. The present release is divided into 21 categories of organisms and others. See also '6. File categories' and '9. File list' below. The contents of the 21 categories are shown in the following. 3.1. Division categories The first 20 divisions are given below; HUM; human PRI; primates (other than human) ROD; rodents MAM; mammals (other than primates and rodents) VRT; vertebrates (other than mammals) INV; invertebrates (animals other than vertebrates) PLN; plants, fungi, plastids (eukaryotes other than animals) BCT; bacteria (including both Eubacteria and Archaea) VRL; viruses PHG; bacteriophages ENV; sequences obtained via environmental sampling methods SYN; synthetic constructs EST; expressed sequence tags; short single pass cDNA sequences GSS; genome survey sequences; short single pass genomic sequences HTC; high throughput cDNA sequences; The sequence submitted from cDNA sequencing projects except for EST. This division is to include unfinished high throughput cDNA sequences, each of which has 5'UTR and 3'UTR at both ends and part of a coding region. The sequence may also include introns. When the sequence becomes finished later, it moves to the corresponding taxonomic division. HTG; high throughput genomic sequences The sequence submitted mainly from genome sequencing projects which regarded a clone as a sequencing unit. STS; sequence tagged sites The tag site for genome sequencing. The information of chromosome, map, PCR_condition is mandatory for this division. PAT; patented data The data submitted to JPO (Japan Patent Office), EPO (European Patent Office), or USPTO (United States Patent and Trademark Office). See also '3.3. Notice for patented data' below. UNA; the data not annotated The UNA division is not used for recently submitted sequences. CON; Contig / Constructed To conjugate a series of entries, such as those submitted from a genome project, each of the three data banks constructs an entry and assign an accession number to a large scale sequence dataset. Such entries are classified into the CON division. The entry in the CON division has the information of joined accession numbers instead of the sequence data. The corresponding entries of the CON entry have been submitted to other divisions. The entries and bases in the CON division are not counted in the released numbers given on the top of the release note. 3.2. TPA separated from primary dataset TPA (Third Party Annotation) data are also available. The TPA data are a complement to the existing DDBJ/EMBL/GenBank comprehensive database of primary nucleotide sequences, which typically result from direct sequencing of cDNAs, ESTs, genomic DNAs etc. Primary entries are defined to be data for which the submitting group has done the sequencing and annotation, and as 'owner' of these data has privileges to submit updates/corrections etc. Primary entries used to build a TPA sequence are those that have been experimentally determined and are publicly available in the DDBJ/EMBL/GenBank databases. They may not be from a proprietary database. The entries and bases in TPA are not counted in the released numbers given on the top of the release note. See also the following URLs; http://www.ddbj.nig.ac.jp/sub/tpa-e.html http://www.insdc.org/TPA.html 3.3. Notice for patented data This release includes PAT division for patented data as described above. The patented data are those which the Japanese Patent Office (JPO), United States Patent and Trademark Office (USPTO), and the European Patent Office (EPO) collected, processed and released. The prefixes of accession numbers for the patented data are shown below; -------------------------- JPO : E, BD, DD, DJ USPTO: I, AR, DZ, EA EPO : A, AX, CQ, CS, FB -------------------------- Note also that unauthorized use of the patented data may cause legal issues for which DDBJ takes no responsibility. 4. DDBJ staff This release is published by the following DDBJ staff. Gojobori T, Tateno Y, Sugawara H, Saitou N, Okubo K, Ikeo K, Suzuki Y, Fukuchi S, Sumiyama K, Ogasawara O, Ogura A, Minezaki Y, Aono H, Ehara Y, Ejima M, Fukuda D, Furuya H, Gojobori M, Hirai T, Hoshi N, Hosokawa T, Ikesaka T, Ikezawa H, Kawamoto T, Kodachi W, Kohira J, Koike T, Kosuge T, Kuroda M, Kusakabe A, Lee K, Maesako H, Maki M, Mamiya H, Mamiya K, Maruyama M, Maruyama N, Mashima J, Murakata N, Nagira S, Nagura M, Nishida S, Nishinomiya N, Nozaki A, Okido T, Sakai K, Sugita R, Tanabe W, Tsuboi M, Tsutsui H, Yagi T, Yamada H, Yamamoto K, Yamamoto M, and Yokoyama E Center for Information Biology and DNA Data Bank of Japan National Institute of Genetics Research Organization of Information and Systems Mishima 411-8540, Japan Phone: +81 55 981 6853 FAX: +81 55 981 6849 E-mail: ddbj@ddbj.nig.ac.jp (for general inquiry) ddbjsub@ddbj.nig.ac.jp (for data submission) ddbjupdt@ddbj.nig.ac.jp (for updates and notification of publication) WWW: http://www.ddbj.nig.ac.jp/ (for DDBJ WWW server) http://sakura.ddbj.nig.ac.jp/ (for DDBJ sequence data submission system) 5. Acknowledgment We are grateful to NCBI and EMBL/EBI for a firm friendship and an excellent collaboration with us. We also thank the Japanese Patent Office for a steady cooperation with us. The operation of DDBJ is supported by the Ministry of Education, Culture, Sports, Science and Technology, and we would gratefully note this here. DDBJ uses the Super-SINET computer network for data collection, data exchange and various services. 6. File categories This release covers 21 categories (see also '3. Dataset categories'.) of organisms and others as follows: ------------------------------------------------------------------------------ ddbjbct*** Category for bacteria ddbjcon*** Category for CON (contig sequences) ddbjenv*** Category for ENV (environmental samples) ddbjest*** Category for EST (expressed sequence tags) ddbjgss*** Category for GSS (genome survey sequences) ddbjhtc*** Category for HTC (high throughput cDNA sequences) ddbjhtg*** Category for HTG (high throughput genomic sequences) ddbjhum*** Category for human ddbjinv*** Category for invertebrates ddbjmam*** Category for mammals other than primates and rodents ddbjpat*** Category for patents ddbjphg*** Category for phages ddbjpln*** Category for plants ddbjpri*** Category for primates other than human ddbjrod*** Category for rodents ddbjsts*** Category for STS (sequence tagged sites) ddbjsyn*** Category for synthetic DNAs ddbjtpa*** Category for TPA (Third Party Annotation) ddbjuna*** Category for unannotated sequences ddbjvrl*** Category for viruses ddbjvrt*** Category for vertebrates other than mammals ------------------------------------------------------------------------------ Some of above in the present release are recorded in multiple ddbj***##.seq files, each of which at most has 1.5 GB storage capacity as follows, respectively. --------------------- ddbjbct : 5 files ddbjenv : 2 files ddbjest : 103 files ddbjgss : 43 files ddbjhtc : 2 files ddbjhtg : 18 files ddbjhum : 5 files ddbjinv : 2 files ddbjpat : 6 files ddbjpln : 5 files ddbjrod : 5 files ddbjsts : 3 files ddbjvrl : 2 files ddbjvrt : 3 files ddbjcon : 14 files --------------------- The index files included in this release are ddbjacc#.idx, ddbjgen.idx, ddbjjou#.idx, and ddbjkey#.idx. See also '9. File list'. All of them except ddbjgen.idx are recorded in multiple ddbj****.idx files, each of which at most has 1.5 GB storage capacity. 7. Sample of the contents in each file 7.1. Part of the contents in the file 'ddbjbct1.seq' This shows all pieces of information on one entry in DDBJ format. ------------------------------------------------------------------------------ LOCUS D87069 993 bp mRNA linear BCT 05-OCT-2006 DEFINITION Escherichia coli mRNA for RNA polymerase sigma subunit, truncated form of sigma-38, complete cds. ACCESSION D87069 VERSION D87069.1 KEYWORDS RNA polymerase sigma subunit, truncated form of sigma-38. SOURCE Escherichia coli ORGANISM Escherichia coli Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; Enterobacteriaceae; Escherichia. REFERENCE 1 (bases 1 to 993) AUTHORS Jishage,M. TITLE Direct Submission JOURNAL Submitted (14-AUG-1996) to the DDBJ/EMBL/GenBank databases. Contact:Miki Jishage National Institute of Genetics, Molecular Genetics; Yata 1111, Mishima, Shizuoka 411, Japan REFERENCE 2 (bases 1 to 993) AUTHORS Jishage,M. and Ishihama,A. TITLE Variation in RNA polymerase sigma subunit composition within different stocks of Escherichia coli starin W3110 JOURNAL Unpublished (1996) REFERENCE 3 AUTHORS Ivanova,A., Renshaw,M., Guntaka,R. and Eisenstark,A. TITLE DNA base sequence variability in katF (putative sigma factor) gene Escherichia coli JOURNAL Nucleic Acids Res. 20, 5479-5480 (1992) REFERENCE 4 AUTHORS Takayanagi,Y., Tanaka,K. and Takahashi,H. TITLE Structure of the 5' upstream region and the regulation of the rpoS gene of Escherichia coli JOURNAL Mol. Gen. Genet. 243, 525-531 (1994) COMMENT FEATURES Location/Qualifiers source 1..993 /db_xref="taxon:562" /mol_type="mRNA" /organism="Escherichia coli" /strain="W3110" CDS 1..810 /note="the gene has four single base changes, resulting in two amino acid substitutions and an amber mutation" /product="RNA polymerase sigma subunit, truncated form of sigma-38" /protein_id="BAA13238.1" /transl_table=11 /translation="MSQNTLKVHDLNEDAEFDENGVEVFDEKALVEYEPSDNDLAEEE LLSQGATQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLV VKIARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMN QTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNER ITSVDTPLGGDSEKALLDILADEKENGPEDTTQDDDMKQSIVKWLFELNAK" variation 75 /citation=[3] /replace="t" variation 97 /citation=[3] /replace="t" variation 99 /citation=[3] /replace="t" variation 808 /citation=[3] /replace="t" BASE COUNT 254 a 223 c 291 g 225 t ORIGIN 1 atgagtcaga atacgctgaa agttcatgat ttaaatgaag atgcggaatt tgatgagaac 61 ggagttgagg tttttgacga aaaggcctta gtagaatatg aacccagtga taacgatttg 121 gccgaagagg aactgttatc gcagggagcc acacagcgtg tgttggacgc gactcagctt 181 taccttggtg agattggtta ttcaccactg ttaacggccg aagaagaagt ttattttgcg 241 cgtcgcgcac tgcgtggaga tgtcgcctct cgccgccgga tgatcgagag taacttgcgt 301 ctggtggtaa aaattgcccg ccgttatggc aatcgtggtc tggcgttgct ggaccttatc 361 gaagagggca acctggggct gatccgcgcg gtagagaagt ttgacccgga acgtggtttc 421 cgcttctcaa catacgcaac ctggtggatt cgccagacga ttgaacgggc gattatgaac 481 caaacccgta ctattcgttt gccgattcac atcgtaaagg agctgaacgt ttacctgcga 541 accgcacgtg agttgtccca taagctggac catgaaccaa gtgcggaaga gatcgcagag 601 caactggata agccagttga tgacgtcagc cgtatgcttc gtcttaacga gcgcattacc 661 tcggtagaca ccccgctggg tggtgattcc gaaaaagcgt tgctggacat cctggccgat 721 gaaaaagaga acggtccgga agataccacg caagatgacg atatgaagca gagcatcgtc 781 aaatggctgt tcgagctgaa cgccaaatag cgtgaagtgc tggcacgtcg attcggtttg 841 ctggggtacg aagcggcaac actggaagat gtaggtcgtg aaattggcct cacccgtgaa 901 cgtgttcgcc agattcaggt tgaaggcctg cgccgtttgc gcgaaatcct gcaaacgcag 961 gggctgaata tcgaagcgct gttccgcgag taa // ------------------------------------------------------------------------------ 7.2. Part of the contents in the accession number index file 'ddbjacc1.idx' The following excerpt from the accession number index file illustrates the format of the index. ------------------------------------------------------------------------------ D00001 ECPBPA BCT X04516 D00002 ECPYRC BCT X04469 D00003 HUMP450M HUM D00003 D00004 FLBFLBL40 VRL D00004 D00005 IBAMEM682 VRL D00005 D00006 BACPNS1981 BCT D00006 D00007 CHKCALGRP VRT D00007 D00008 ECPNTAB BCT X04195 D00009 DROPER1 INV D00009 ------------------------------------------------------------------------------ 7.3. Part of the contents in the keyword phrase index file 'ddbjkey1.idx' Keyword phrases consist of names for gene products and other characteristics of sequence entries. ------------------------------------------------------------------------------ "COAT PROTEIN SMO511347 VRL AJ511347 'TNPA GENE UBA564903 BCT AJ564903 'ZINC-FINGER' MOTIF PRNS53 VRL X60546 (+) MATING TYPE SURFACE PROTEIN ABGPSSP PLN M94861 (1,3 TABETGLUB PLN Z22874 (1,3)-BETA-D-GLUCAN BINDING PROTEIN AJ606470 INV AJ606470 (1,3)BETA-GLUCAN SYNTHASE NCU09275 PLN U09275 (1,4)-BETA-D-ARABINOXYLAN ARABINOFURANOHYDROLASE ANAXHA PLN Z78011 ANTUAXHA PLN Z78010 (1,6)-BETA-GLUCAN BIOSYNTHESIS YSAKRE1A PLN M81588 (1-3)-BETA-GLUCANASE NTSP41AGN PLN X81560 PA13BGPT PLN X57794 (1-3,1-4)-BETA-D-GLUCANASE HVBDG PLN X52572 (1-4)-BETA-MANNAN ENDOHYDROLASE CAR278996 PLN AJ278996 CAR293305 PLN AJ293305 (2',5'-OLIGOISOADENYLATE SYNTHETASE-DEPENDENT) AL138776 HUM AL138776 (2'-5') OLIGO(A) SYNTHASE E16 SSO4G06 EST F14610 (2'-5')OLIGOADENYLATE SYNTHETASE HSA225089 HUM AJ225089 HUMSYN25A HUM D00068 SSA225090 MAM AJ225090 (6')-IB' AMINOGLYCOSIDE ACETYLTRANSFERASE AXY278514 BCT AJ278514 PAE291609 BCT AJ291609 (8,11)-LINOLEOYL DESATURASE COF245938 PLN AJ245938 ------------------------------------------------------------------------------ 7.4. Part of the contents in the journal citation index file 'ddbjjou1.idx' The journal citation index file lists all of the citations that appear in the references. ------------------------------------------------------------------------------ (ER) AAPS PHARMSCI. 4 (3), DOI 10.1208/PS040315 (2002) AY170916 ROD AY170916 (ER) AM. J. HUM. GENET. 76 (1) (2004) IN PRESS AY753209S1 HUM AY753209 AY753209S2 HUM AY753210 (ER) ARCH. VIROL. (2004) IN PRESS AF531505 VRL AF531505 AY518899 VRL AY518899 AY518900 VRL AY518900 AY518901 VRL AY518901 AY518902 VRL AY518902 AY518903 VRL AY518903 AY518904 VRL AY518904 AY518905 VRL AY518905 AY518906 VRL AY518906 AY518907 VRL AY518907 AY518908 VRL AY518908 AY518909 VRL AY518909 AY518910 VRL AY518910 AY518911 VRL AY518911 AY518912 VRL AY518912 AY518913 VRL AY518913 AY518914 VRL AY518914 AY518915 VRL AY518915 AY518916 VRL AY518916 AY518917 VRL AY518917 AY518918 VRL AY518918 AY518919 VRL AY518919 AY518920 VRL AY518920 AY518921 VRL AY518921 AY518922 VRL AY518922 AY518923 VRL AY518923 AY518924 VRL AY518924 AY518925 VRL AY518925 AY518926 VRL AY518926 AY518927 VRL AY518927 AY518928 VRL AY518928 AY518929 VRL AY518929 AY518930 VRL AY518930 AY518931 VRL AY518931 AY518932 VRL AY518932 AY521234 VRL AY521234 AY521235 VRL AY521235 AY521236 VRL AY521236 AY521237 VRL AY521237 AY521238 VRL AY521238 (ER) ARTERIOSCLER. THROMB. VASC. BIOL. (2004) IN PRESS AY563557 HUM AY563557 (ER) BIOCHEM. BIOPHYS. RES. COMMUN. 325 (1), 203-214 (2004) AY563137 HUM AY563137 (ER) BIOCHEM. J./10.1042/BJ20030293 HSA496460 HUM AJ496460 ------------------------------------------------------------------------------ 7.5. Part of the contents in the gene name index file 'ddbjgen.idx' This file lists all the gene names that appear in the feature table. ------------------------------------------------------------------------------ 'ARR BX927156 BCT BX927156 'BGLG BX927156 BCT BX927156 'BGLS BX927148 BCT BX927148 'BGLY' BX927156 BCT BX927156 'BRNQ AF305888 BCT AF305888 'COMK AL591983 BCT AL591983 AL596172 BCT AL596172 'CRCB BX927155 BCT BX927155 'CRTI BX927155 BCT BX927155 'DPPE LDDIPEP BCT Z34898 'FIC BX936398 BCT BX936398 ------------------------------------------------------------------------------ 8. Release history Release Date Entries Bases Comments 72 12/07 79,004,098 82,592,245,487 71 09/07 76,273,345 79,706,204,461 70 06/07 72,801,679 76,788,510,646 69 03/07 67,523,680 71,775,679,500 PROJECT line started Indexes for each category terminated 68 12/06 64,267,978 68,259,314,742 1.5 GB storage started 67 09/06 61,144,621 65,443,024,193 66 06/06 58,176,628 62,945,843,881 65 03/06 55,890,995 60,564,721,635 TPA subcategories started 64 12/05 52,272,669 56,098,558,378 Some index files split 63 09/05 47,741,593 52,246,110,341 62 06/05 45,249,444 49,158,155,283 ENV started Version for release note started 61 03/05 43,118,204 47,099,081,750 Changed style of release note 60 12/04 40,583,945 44,416,752,273 /db_xref="H-inv:**" started 59 09/04 37,926,117 42,245,956,937 58 06/04 34,917,581 39,812,635,108 57 03/04 32,693,678 38,008,449,840 56 12/03 30,405,173 36,079,046,032 55 09/03 27,753,140 34,280,225,489 54 06/03 25,149,821 32,162,041,177 53 02/03 23,250,813 29,711,299,332 52 12/02 20,354,812 26,931,456,316 51 09/02 18,401,358 22,782,404,136 TPA started 50 06/02 17,260,693 20,158,357,982 49 04/02 16,503,157 18,579,627,226 48 01/02 15,016,100 16,197,713,855 47 10/01 13,266,610 14,145,671,645 46 07/01 12,313,759 13,037,646,166 45 04/01 11,434,113 12,207,092,905 HTC division started 44 01/01 10,165,597 11,136,298,841 43 10/00 8,666,551 10,034,532,698 42 07/00 7,554,995 8,880,721,093 41 04/00 5,962,608 6,409,581,885 CON division started 40 01/00 5,388,125 4,762,696,173 RNA division terminated 39 10/99 4,810,773 3,728,000,562 NID and PID discarded 38 07/99 4,294,369 3,098,519,597 37 03/99 3,311,627 2,375,261,951 VERSION, /protein_id started 36 01/99 3,073,166 2,190,425,560 35 10/98 2,759,261 1,957,341,169 34 07/98 2,412,785 1,708,580,623 33 04/98 2,174,769 1,479,303,279 32 01/98 1,956,669 1,300,950,613 31 10/97 1,731,532 1,139,869,464 Adoption of the unified taxonomy database 30 07/97 1,534,115 992,788,339 NID and PID terminated 29 04/97 1,270,194 841,415,232 28 01/97 1,154,120 756,785,219 HTG division started ORG division terminated 27 10/96 936,697 608,103,057 GSS division started 26 07/96 835,552 551,932,448 25 04/96 744,490 499,300,364 /translation started 24 01/96 637,508 431,771,652 23 10/95 569,757 390,694,350 22 07/95 437,588 322,982,425 HUM division started 21 04/95 274,596 250,875,023 20 01/95 239,689 231,299,557 19 10/94 204,332 205,274,131 18 07/94 185,230 192,473,021 17 04/94 169,957 179,942,209 16 01/94 154,626 165,017,628 15 10/93 131,649 147,224,690 14 07/93 120,350 138,686,333 13 04/93 112,067 129,784,445 12 01/93 97,683 120,815,244 EST division started 11 07/92 65,693 84,839,075 10 01/92 59,317 77,805,556 GenBank/EMBL inclusion started 9 07/91 1,130 2,002,124 8 01/91 879 1,573,442 7 07/90 681 1,154,211 6 01/90 496 841,236 5 07/89 395 679,378 4 01/89 302 535,985 3 07/88 230 345,850 2 01/88 142 199,392 1 07/87 66 108,970 Started with DDBJ only ------------------ Since release 69 ------------------ Introduction of the project ID at PROJECT line in DDBJ flat file: Following the agreement at the INSD collaborative meeting in 2006, INSDC has started to assign the project ID for submissions from sequencing projects. The description of project ID is shown as below; ---------------------------------------------------------------------------- A unique identifier, assigned at the time of the submission by a sequencing project that informed INSDC of the submission beforehand. It is recommended that the submitter quotes the assigned project ID in all communication with INSDC databases to allow for easier and faster tracking of issues. The project ID field provides an umbrella identifier that points to all related sequence data for the project. ---------------------------------------------------------------------------- The PROJECT lines contain INSDC-assigned ID for the sequencing project. It will be appeared between VERSION and KEYWORDS lines in DDBJ flat files, from the DDBJ periodical release, 69 as shown below. See also '2. DDBJ flat file format'. ---------------------------------------------------------------------------- ACCESSION AB012345 VERSION AB012345.1 PROJECT GenomeProject:123 KEYWORDS . ---------------------------------------------------------------------------- Termination of providing the index files for each category: For users logging in one of our computers (supernig), we provided index files for each category. However, as the computer system in our institute was replaced with a new one which does not have a service using the index files, we terminated providing the index files. ------------------ Since release 68 ------------------ Split of files: We changed the maximum file size from 300 MB to 1.5 GB, because the network capacity has been remarkably increased. Each file named as ddbj***##.seq has at most 1.5 GB storage capacity. See also the sections, '6. File categories' and '9. File list'. ------------------ Since release 65 ------------------ Introduction of two types of TPA entries: According to the decision of ICM 2005, TPA data set is now classified into two categories, "TPA:experimental" and "TPA:inferential", to distinguish TPA annotation supported by wet-lab. experimental evidence and that inferred. The retrofit to divide TPA entries into two categories starts from the release 65. You can find the description of the two TPA categories at the following URLs; http://www.ddbj.nig.ac.jp/sub/tpa-e.html http://www.insdc.org/TPA.html See also '3.2. TPA separated from primary dataset'. ------------------ Since release 64 ------------------ Split of index files: In the present release, some of index files (ddbjacc.idx, ddbjjou.idx, and ddbjkey.idx) have been greater than 2 GB in the file size. So, these have been recorded in multiple ddbj****.idx files, each of which at most has 1.5 GB storage capacity as follows, respectively. See also 6., 7.2., 7.3., 7.4. and 9. ------------------ Since release 62 ------------------ Release version number is introduced: DDBJ has started to include the item, 'version', for its release note, which indicates a version for its periodical release. It is expressed like '62.0', in which the digit(s) after the period is a version number. The reason for adding the version number is that a released data is sometimes revised due to urgent and necessary corrections. The number is increased by one every time when a revised periodical release is made public until the next release. Introduction of ENV division: Recently, the submissions of the sequences derived from environmental samples have rapidly increased. To accommodate such submissions, a new division, ENV, has been created (See also '3.1. Division categories'). This division contains the sequences obtained via direct molecular isolation such as PCR, DGGE, or any anonymous method. In the past, the sequences derived from environmental samples belonged to taxonomic divisions, mainly BCT. At DDBJ, the retrofit to transfer relevant entries from taxonomic divisions to the ENV division starts in the present release, and ends by the next periodical release. Please note that during this transitional period, some entries to be eventually placed in the ENV division will be found in other divisions. Strand information is removed: The strand information of LOCUS line in the flat file has been removed as shown below. See also '2.1. LOCUS line'. ---------------------------------------------------------------------------- Old (-rel. 61): 44-44 space 45-47 spaces, ss- (single-stranded), ds- (double-stranded), or ms- (mixed-stranded) New (rel. 62-): 44-47 spaces ---------------------------------------------------------------------------- ------------------ Since release 61 ------------------ The style of release note (this file) has been changed. Some entries have the sequential format for the secondary accession numbers in the ACCESSION line, in order to make the expression of secondary accession numbers in the past short. For example; ------------------------------------------------------------------------------ Before; ACCESSION AB000802 D85885 D85886 D85887 After; ACCESSION AB000802 D85885-D85887 ------------------------------------------------------------------------------ See also '2.3. ACCESSION line'. ------------------ Since release 60 ------------------ The cross-reference to the H-invitational has been included. ------------------ Since release 56 ------------------ The three data banks have agreed that the maximum length limitation (350 kb) of a submitted sequence be relaxed. The BASE COUNT line of the DDBJ flat file format has been changed, corresponding to the relaxation of the maximum sequence length restriction in the entry that had been practiced at DDBJ/EMBL/GenBank International Nucleotide Sequence Databases. In the BASE COUNT line of the DDBJ flat file, 6 digits had been allocated for each number of a, c, g, t and other bases in the sequence. Hereafter, in the new flat file format, 9 digits are allocated for each number of a, c, g and t, while the numbers of other bases are removed. In accordance with the relaxation of sequence length limitation, GenBank had already dropped the BASE COUNT line from their flat file format from GenBank Release 138 (Oct. 2003). We DDBJ have decided to maintain the BASE COUNT line in our flat file format from the view that GC contents are still important information to characterize the sequence. The changes in the BASE COUNT line are shown below. ---------------------------------------------------------------------------- Old (-rel. 55): 1 6 11 16 21 26 31 36 41 46 51 56 61 66 71 |----|----|----|----|----|----|----|----|----|----|----|----|----|----| BASE COUNT 123456 a 123456 c 123456 g 123456 t 123456 others New (rel. 56-): 1 6 11 16 21 26 31 36 41 46 51 56 61 66 71 |----|----|----|----|----|----|----|----|----|----|----|----|----|----| BASE COUNT 123456789 a 123456789 c 123456789 g 123456789 t ---------------------------------------------------------------------------- The SOURCE in the flat file is revisited and revised if necessary in accordance with the unified taxonomy database common to the three data banks. ------------------ Since release 54 ------------------ '/sequenced_mol' qualifier has been changed to '/mol_type' qualifier. We accordingly completed retrofitting the pertinent entries. This change was made on the agreement at the INSD collaborative meeting in 2002. ------------------ Since release 51 ------------------ The TPA (Third Party Annotation) dataset has been available. The dataset is a complement to the existing DDBJ/EMBL/GenBank database of the primary nucleotide sequences which were obtained from direct sequencing of cDNAs, ESTs, genomic DNAs etc. The format of LOCUS line in the flat file has been changed as shown below to adjust to the GenBank format. ------------------------------------------------------------------------------ Old (-rel. 50): LOCUS AB000001 660 bp DNA PLN 01-FEB-2001 New (rel. 51-): LOCUS AB000001 660 bp DNA linear PLN 01-FEB-2001 ------------------------------------------------------------------------------ ------------------ Since release 45 ------------------ The HTC (High Throughput cDNA) division has been included. This is to include unfinished high throughput cDNA sequences, each of which has 5'UTR and 3'UTR at both ends and part of a coding region. The sequence may also include introns. When the sequence becomes finished later, it moves to the corresponding taxonomic division. The sequence is accompanied with a keyword, HTC (High Throughput cDNA), which is dropped when the sequence is finished and moved to a taxonomic division. ------------------ Since release 41 ------------------ The CON division has been included. This division is to show the order of related sequences in a genome, and expressed by join and the accession numbers of the sequences. The contents of the CON division are compiled by the three data banks not by the data submitter. ------------------ Since release 40 ------------------ The RNA division was terminated. The RNA data have been redistributed according to the category of the organism. Therefore, you will find a human RNA sequence, for example, in the HUM division. ------------------ Since release 37 ------------------ The three data banks include the item VERSION in the flat file, which indicates a version of a submitted nucleotide sequence. It is expressed like AB123456.1, in which the digit(s) after the period is a version number. The reason for adding VERSION is that since a released sequence sometimes revised by the submitter, the accession number alone cannot specify the sequence in question causing the user a trouble. The number is increased by one every time when a revised sequence is made public. Accordingly, the translated protein sequence will be accompanied with a /protein_id which is expressed as BAA12345.1, in which the digit(s) after the period is again a version number. The number is increased by one when the corresponding nucleotide sequence is revised and the protein sequence is changed as a result, and when the revised protein sequence is made public. ------------------ Since release 31 ------------------ We have started adopting the unified taxonomy database to unify the biological source of the sequence. The database is made up with scientific names, ID of unidentified organisms, and synthetic constructs etc. ------------------ Since release 30 ------------------ NID and PID were terminated. This change was made on the agreement at the INSD collaborative meeting in 1999. ------------------ Since release 28 ------------------ The HTG (High Throughput Genomic sequence) has been included. This division was created to cope with genome project teams which deal with a clone as a sequencing unit. We terminated the ORG (Organelle) division. Thus, if you are interested in human mitochondrial sequences, for example, you are now advised to refer to the HUM division. ------------------ Since release 27 ------------------ The GSS division has been included. GSS stands for Genome Survey Sequence, which is similar to EST, except that GSS is genomic DNA whereas EST is cDNA. ------------------ Since release 25 ------------------ DDBJ release contains amino acid sequences that were translated from the corresponding nucleotide sequences of the database. In the translation we paid much attention to the fact that some species or organella have a codon different from the universal one, and used the proper codon table. ------------------ Since release 22 ------------------ The HUM division has been included. Human genome projects have probably been most productive and yielded a large number of sequences Thus, we have the human (HUM) division solely for human sequences and the primate (PRI) division for non-human primate sequences. ------------------ Since release 12 ------------------ The EST (Expressed Sequence Tag) division has been included. The number of ESTs has been increasing at an enormous rate and is expected to be growing even more rapidly in the future. Thus, we created a division for ESTs ------------------ Since release 10 ------------------ The sequences submitted to GenBank or EMBL have been included in the release. 9. File list The files in this release are arranged in the following order with non-labeled format. ----------------------------------------------------------------------- file name file size ----------------------------------------------------------------------- ddbjrel.txt (DDBJ release note) 65145 ddbjacc1.idx (Accession number index file 1) 1499999975 ddbjacc2.idx (Accession number index file 2) 1500000012 ddbjacc3.idx (Accession number index file 3) 70551125 ddbjgen.idx (Gene name index file) 114057716 ddbjjou1.idx (Journal citation index file 1) 1499980559 ddbjjou2.idx (Journal citation index file 2) 1488174203 ddbjjou3.idx (Journal citation index file 3) 393042601 ddbjkey1.idx (Keyword phrase index file 1) 409180214 ddbjkey2.idx (Keyword phrase index file 2) 1326026956 ddbjkey3.idx (Keyword phrase index file 3) 1484399989 ddbjkey4.idx (Keyword phrase index file 4) 64347552 ----------------------------------------------------------------------- file name number of entries number of bases file size ----------------------------------------------------------------------- ddbjbct1.seq 119885 615254014 1506189343 ddbjbct2.seq 85747 637378747 1505532657 ddbjbct3.seq 322 674710080 1499044243 ddbjbct4.seq 99975 614613197 1499000609 ddbjbct5.seq 41764 86166730 230789956 ddbjenv1.seq 589955 396017147 1499000434 ddbjenv2.seq 75703 55568550 197675433 ddbjest1.seq 462722 173137769 1499001874 ddbjest2.seq 490497 191891179 1499000583 ddbjest3.seq 497900 205896285 1499002404 ddbjest4.seq 480015 204852431 1499002733 ddbjest5.seq 544729 297948288 1499001314 ddbjest6.seq 561193 337364963 1499001028 ddbjest7.seq 546492 281558952 1499002017 ddbjest8.seq 329854 91055259 1499005489 ddbjest9.seq 566267 264122732 1499001513 ddbjest10.seq 494508 215161630 1499000593 ddbjest11.seq 463943 192211656 1499002803 ddbjest12.seq 313708 109247292 1499002813 ddbjest13.seq 271521 83097237 1499000806 ddbjest14.seq 271758 114564841 1499002190 ddbjest15.seq 419759 192810814 1499000518 ddbjest16.seq 481918 250620157 1499002443 ddbjest17.seq 460000 260289938 1499002119 ddbjest18.seq 446383 238730245 1499001191 ddbjest19.seq 463018 224016020 1499001944 ddbjest20.seq 466455 287522205 1499000543 ddbjest21.seq 481233 267352117 1499002635 ddbjest22.seq 452993 255318584 1499000788 ddbjest23.seq 440283 263081889 1499002827 ddbjest24.seq 553920 300632711 1499000941 ddbjest25.seq 517113 304537807 1499001003 ddbjest26.seq 408821 205036765 1499003291 ddbjest27.seq 430022 252863257 1499001971 ddbjest28.seq 489626 280632098 1499000004 ddbjest29.seq 519996 245693787 1499001303 ddbjest30.seq 450241 242298822 1499000481 ddbjest31.seq 444592 259100415 1499002500 ddbjest32.seq 437229 306898640 1499000782 ddbjest33.seq 410294 276244655 1499000539 ddbjest34.seq 565973 341233346 1499000996 ddbjest35.seq 608608 329810692 1499002769 ddbjest36.seq 448252 299306143 1499002702 ddbjest37.seq 346407 190963179 1499005101 ddbjest38.seq 255823 97231357 1499002724 ddbjest39.seq 252349 104703480 1499002045 ddbjest40.seq 395377 193956063 1499001165 ddbjest41.seq 442760 279844684 1499001778 ddbjest42.seq 478808 244972213 1499001355 ddbjest43.seq 450323 246032681 1499001220 ddbjest44.seq 536151 305731815 1499002359 ddbjest45.seq 445216 240799200 1499001543 ddbjest46.seq 495131 284233069 1499000278 ddbjest47.seq 522164 266598513 1499000497 ddbjest48.seq 426638 259501086 1499003041 ddbjest49.seq 306790 160410828 1499004573 ddbjest50.seq 261525 121386340 1499000869 ddbjest51.seq 265728 104038776 1499003424 ddbjest52.seq 341995 155282604 1499003138 ddbjest53.seq 507384 312741347 1499000171 ddbjest54.seq 487797 300469065 1499000785 ddbjest55.seq 435372 253010959 1499000660 ddbjest56.seq 444841 257816936 1499000260 ddbjest57.seq 478083 272561141 1499000186 ddbjest58.seq 454881 259022299 1499001608 ddbjest59.seq 427396 244190413 1499002467 ddbjest60.seq 444546 258755658 1499007335 ddbjest61.seq 499473 305447023 1499001222 ddbjest62.seq 460628 298600075 1499003397 ddbjest63.seq 464767 238327463 1499000963 ddbjest64.seq 446795 276563114 1499002158 ddbjest65.seq 419716 270371468 1499004554 ddbjest66.seq 373862 249929108 1499000883 ddbjest67.seq 448223 239440878 1499000265 ddbjest68.seq 425840 238842787 1499000933 ddbjest69.seq 433737 238356690 1499003178 ddbjest70.seq 458856 248361376 1499002457 ddbjest71.seq 529950 314092541 1499001169 ddbjest72.seq 462841 283263629 1499000932 ddbjest73.seq 396538 303399881 1499002494 ddbjest74.seq 497540 289915429 1499001091 ddbjest75.seq 408145 285142963 1499003928 ddbjest76.seq 383193 256394101 1499002182 ddbjest77.seq 378854 270902246 1499000914 ddbjest78.seq 426525 293646276 1499000701 ddbjest79.seq 422982 317797401 1499001688 ddbjest80.seq 471435 311402212 1499000649 ddbjest81.seq 460464 298111905 1499001401 ddbjest82.seq 550478 252365789 1499002035 ddbjest83.seq 565856 266490177 1499001962 ddbjest84.seq 483881 312705599 1499003616 ddbjest85.seq 521054 304149553 1499002998 ddbjest86.seq 582346 318939574 1499001175 ddbjest87.seq 619844 263162222 1499001211 ddbjest88.seq 523675 303802390 1499001684 ddbjest89.seq 488331 305893302 1499000543 ddbjest90.seq 540469 306531967 1499001819 ddbjest91.seq 515117 324983467 1499000821 ddbjest92.seq 421457 238089530 1499002801 ddbjest93.seq 613138 185058813 1499000875 ddbjest94.seq 518672 273641989 1499001646 ddbjest95.seq 474627 292053995 1499000594 ddbjest96.seq 506426 292135811 1499003631 ddbjest97.seq 487744 315340698 1499000670 ddbjest98.seq 576921 242981229 1499002388 ddbjest99.seq 570383 271171002 1499001499 ddbjest100.seq 433649 291073908 1499002247 ddbjest101.seq 479515 293807100 1499002201 ddbjest102.seq 453792 266729488 1499003234 ddbjest103.seq 390915 144245466 1238306223 ddbjgss1.seq 482669 349253415 1499001552 ddbjgss2.seq 478466 335653624 1499001659 ddbjgss3.seq 474299 329180572 1499000456 ddbjgss4.seq 528621 253627145 1499000604 ddbjgss5.seq 474301 247963964 1499001111 ddbjgss6.seq 436110 235205767 1499001258 ddbjgss7.seq 400204 201752081 1499000006 ddbjgss8.seq 441938 234851962 1499000890 ddbjgss9.seq 526751 305567787 1499000158 ddbjgss10.seq 547925 308267860 1499002166 ddbjgss11.seq 500766 325376739 1499001227 ddbjgss12.seq 541301 313953040 1499001164 ddbjgss13.seq 504134 389377671 1499002469 ddbjgss14.seq 547384 357594810 1499000513 ddbjgss15.seq 627554 326638870 1499001557 ddbjgss16.seq 576890 412409628 1499001898 ddbjgss17.seq 555124 284368559 1499001348 ddbjgss18.seq 507152 370886241 1499002223 ddbjgss19.seq 549147 371018363 1499001186 ddbjgss20.seq 606945 385493517 1499000198 ddbjgss21.seq 593114 409585359 1499000597 ddbjgss22.seq 513571 306165740 1499001398 ddbjgss23.seq 514732 326299576 1499002107 ddbjgss24.seq 536813 357868870 1499000762 ddbjgss25.seq 533711 341759918 1499000357 ddbjgss26.seq 549025 329906334 1499001215 ddbjgss27.seq 531649 280321785 1499000847 ddbjgss28.seq 476922 328932129 1499002345 ddbjgss29.seq 486001 379288513 1499000753 ddbjgss30.seq 554446 356324436 1499001459 ddbjgss31.seq 538127 345597020 1499002594 ddbjgss32.seq 483363 344170423 1499001887 ddbjgss33.seq 534954 297319588 1499000829 ddbjgss34.seq 531373 324930250 1499001150 ddbjgss35.seq 509150 261357594 1499002404 ddbjgss36.seq 413379 336216119 1499000082 ddbjgss37.seq 420062 347045825 1499003132 ddbjgss38.seq 425775 339283010 1499001756 ddbjgss39.seq 421224 345331246 1499002971 ddbjgss40.seq 425188 348395785 1499002231 ddbjgss41.seq 419836 339258440 1499002463 ddbjgss42.seq 475116 349542869 1499001243 ddbjgss43.seq 97687 69128452 288072689 ddbjhtc1.seq 291575 351953423 1499001082 ddbjhtc2.seq 202098 215301358 756441127 ddbjhtg1.seq 11402 1118404302 1499217460 ddbjhtg2.seq 7554 1118312587 1499024653 ddbjhtg3.seq 5880 1131041331 1499061039 ddbjhtg4.seq 5471 1140241366 1499382293 ddbjhtg5.seq 5293 1144704742 1499524613 ddbjhtg6.seq 5312 1144662622 1499044370 ddbjhtg7.seq 6527 1132625420 1499160081 ddbjhtg8.seq 6904 1141608752 1499133806 ddbjhtg9.seq 5865 1136802411 1499087347 ddbjhtg10.seq 6198 1130346947 1499090448 ddbjhtg11.seq 6517 1126479509 1499188540 ddbjhtg12.seq 7496 1116539369 1499138121 ddbjhtg13.seq 6899 1145722959 1499141623 ddbjhtg14.seq 7218 1141184973 1499078037 ddbjhtg15.seq 7429 1141147820 1499011923 ddbjhtg16.seq 7316 1147116741 1499020523 ddbjhtg17.seq 6256 1131996651 1499030156 ddbjhtg18.seq 1057 131559670 172839293 ddbjhum1.seq 24186 1056361228 1499014333 ddbjhum2.seq 8131 1069881787 1499159752 ddbjhum3.seq 133851 857600623 1499111731 ddbjhum4.seq 60906 1002369626 1499001724 ddbjhum5.seq 197345 401630413 1088790004 ddbjinv1.seq 215375 723693823 1499001799 ddbjinv2.seq 321127 370169011 1164723367 ddbjmam.seq 152550 353036144 783387731 ddbjpat1.seq 1035368 520046213 1499002998 ddbjpat2.seq 776826 494060157 1499000740 ddbjpat3.seq 744996 347188737 1499000698 ddbjpat4.seq 689632 609008436 1499000595 ddbjpat5.seq 676409 441217495 1499002563 ddbjpat6.seq 600843 188890372 791030833 ddbjphg.seq 3551 26106203 63819414 ddbjpln1.seq 204090 784729838 1498999986 ddbjpln2.seq 163118 695411347 1499007876 ddbjpln3.seq 53025 929976507 1499001274 ddbjpln4.seq 356984 548539066 1499000927 ddbjpln5.seq 185882 175345268 588296545 ddbjpri.seq 61193 969092509 1382188060 ddbjrod1.seq 33803 1021326751 1499063582 ddbjrod2.seq 5912 1094085528 1499157174 ddbjrod3.seq 41043 1052301769 1499231743 ddbjrod4.seq 110821 887283338 1499000028 ddbjrod5.seq 153585 59671515 333227083 ddbjsts1.seq 422213 210766659 1499000228 ddbjsts2.seq 339654 239126334 1499000355 ddbjsts3.seq 169837 74593637 493640419 ddbjsyn.seq 54238 75883002 267113799 ddbjuna.seq 278 480583 1362056 ddbjvrl1.seq 399258 403386343 1499003057 ddbjvrl2.seq 104960 107040767 384853074 ddbjvrt1.seq 234082 698877486 1499137706 ddbjvrt2.seq 34875 1105591818 1499102837 ddbjvrt3.seq 133659 173485878 496739720 ------------------------------------------------------------------------------ Total 79004098 82592245487 295550649999 ddbjtpa.seq 5734 338718573 46704249 ddbjcon1.seq 323603 0 1498978410 ddbjcon2.seq 351564 0 1499003566 ddbjcon3.seq 276028 0 1499000486 ddbjcon4.seq 234814 0 1499003107 ddbjcon5.seq 276752 0 1499003811 ddbjcon6.seq 283501 0 1499002106 ddbjcon7.seq 334425 0 1499000460 ddbjcon8.seq 400615 0 1499001873 ddbjcon9.seq 290478 0 1499000057 ddbjcon10.seq 339952 0 1499001536 ddbjcon11.seq 385385 0 1499001926 ddbjcon12.seq 254859 0 1499005034 ddbjcon13.seq 311641 0 1499005762 ddbjcon14.seq 169126 0 1005316481 The entries and bases in the CON division and TPA dataset are not counted in the numbers given on the top of the release note or 'Total' on the above table.