DNA Data Bank of Japan DNA Database Release 73.0, Mar. 2008, including 83,167,582 entries, 86,099,950,395 bases ------------------------------------------------------------------------------- Table of contents ------------------------------------------------------------------------------- 1. Introduction 1.1. Announcement for changes in the present release 1.2. Announcement for the forthcoming changes 2. DDBJ flat file format 2.1. LOCUS line 2.2. DEFINITION line 2.3. ACCESSION line 2.4. VERSION line 2.5. KEYWORDS line 2.6. SOURCE line 2.7. REFERENCE line 2.8. COMMENT line 2.9. FEATURES line 2.10. BASE COUNT line 2.11. ORIGIN line 3. Dataset categories 3.1. Division categories 3.2. TPA separated from primary dataset 3.3. Notice for patent related sequence data 4. DDBJ staff 5. Acknowledgment 6. File categories 7. Sample of the contents in each file 7.1. Part of the contents in the file 'ddbjbct1.seq' 7.2. Part of the contents in the accession number index file 'ddbjacc1.idx' 7.3. Part of the contents in the keyword phrase index file 'ddbjkey1.idx' 7.4. Part of the contents in the journal citation index file 'ddbjjou1.idx' 7.5. Part of the contents in the gene name index 'ddbjgen.idx' 8. Release history 9. File list ------------------------------------------------------------------------------- 1. Introduction This database contains nucleotide sequence data for any organism, not only those with DNA genomes but also those with RNA genomes. This database may be copied and redistributed without permission on the condition that all the statements in this release note are reproduced in each copy. See also '3.3. Notice for patented data' below. The present release contains the newest data prepared by the DNA Data Bank of Japan (DDBJ), GenBank (*), and European Molecular Biology Laboratory/European Bioinformatics Institute (EMBL/EBI) as of Feb 22, 2008. This unified database was made possible thanks to the international collaboration among the three data banks. All the entries have accordingly been annotated using the feature keys common to them. *'GenBank' is a trademark of NIH, USA, and is operated by National Center for Biotechnology Information (NCBI) at NIH. 1.1. Announcement for changes in the present release Introduction of the sequence data from the Korean Intellectual Property Office: From the present release, the nucleotide sequence data transferred from Korean Intellectual Property Office (KIPO) have been included in DDBJ release. See also, '3.1. Division categories' and '3.3. Notice for patent related sequence data'. 1.2. Announcement for the forthcoming changes Nothing particular. 2. DDBJ flat file format The database is a collection of "entry" which is the unit of the data. The entries submitted to databanks were processed and publicized according to the DDBJ format for distribution (flat file). The flat file includes the sequence and the information of submitters, references, source organisms, and "feature" information, etc. The items of the DDBJ flat file are explained at following; ------------------------------------------------------------------------------- LOCUS AB000000 450 bp mRNA linear HUM 08-JUL-2002 DEFINITION Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds. ACCESSION AB000000 VERSION AB000000.1 KEYWORDS . SOURCE Homo sapiens ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 450) AUTHORS Mishima,H. and Shizuoka,T. TITLE Direct Submission JOURNAL Submitted (30-NOV-2000) to the DDBJ/EMBL/GenBank databases. Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; 1111, Yata, Mishima, Shizuoka 411-8540, Japan REFERENCE 2 (sites) AUTHORS Mishima,H., Shizuoka,T. and Fuji,I. TITLE Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver JOURNAL Unpublished (2002) COMMENT Human cDNA sequencing project. FEATURES Location/Qualifiers source 1..450 /chromosome="12" /clone="GT200015" /clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)" /map="12p13" /mol_type="mRNA" /organism="Homo sapiens" /tissue_type="liver" CDS 86..>450 /codon_start=1 /gene="GAPD" /product="glyceraldehyde-3-phosphate dehydrogenase" /protein_id="BAA12345.1" /transl_table=1 /translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV" BASE COUNT 102 a 119 c 131 g 98 t ORIGIN 1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct 61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg 121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc 181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt 241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg 301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac 361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc 421 tcaacttaag ggtggtgcta agaaggtctg // ------------------------------------------------------------------------------- 2.1. LOCUS line The format of LOCUS line in the flat file is shown below; --------- -------- Positions Contents --------- -------- 01-05 'LOCUS' 06-12 spaces 13-28 Locus name 29-29 space 30-40 Length of sequence, right-justified 41-41 space 42-43 'bp' 44-47 spaces 48-54 DNA, RNA, mRNA, pre-RNA, rRNA, scRNA, snRNA, snoRNA, tRNA, left justified 55-55 space 56-63 'linear' followed by two spaces, or 'circular' 64-64 space 65-67 The division code (see '3.1. Division categories') 68-68 space 69-79 Date, in the form dd-MMM-yyyy (e.g., 08-JUL-2002) ------------------------------------------------------------------------------ 2.2. DEFINITION line The definition briefly describes the information of gene(s). "DEFINITION" is constructed by each of the three data banks. 2.3. ACCESSION line This line shows accession number of the entry data. A unique accession number is issued to the data submitter by each of the three data banks. The accession number is composed of 1 alphabet character and 5 digits (ex. A12345) or 2 alphabet characters and 6 digits (ex. AB123456). The former style was used in 1980s, but later the latter style was introduced because of data explosion. All the entries designated by the accession numbers with the prefixes given below have been collected and processed by DDBJ, and the rest have been done by GenBank and EMBL/EBI. ------------------------------------------------------------------------------- C, D, E, AB, AG, AK, AP, AT, AU, AV, BA, BB, BD, BJ, BP, BR, BS, BW, BY, CI, CJ, DA, DB, DC, DD, DE, DF, DG, DH, DI, DJ ------------------------------------------------------------------------------- You can find the list of the prefixes of the accession numbers at the following URL; http://www.ddbj.nig.ac.jp/sub/prefix.html If multiple entries are united to an entry, or if an entry is extensively modified after the submission, the responsible data banks may assign a new accession number to it. In these cases, the new accession number is called the primary accession number, and the old accession number(s) is/are called the secondary accession number(s). In the flat file, the primary accession number is indicated first, then the secondary accession number(s) follows. You can find the same updated entry with both the primary and the secondary accession numbers. 2.4. VERSION line This line consists of an accession number and a version number, like "AB123456.1", in which the digit(s) after the period is a version number. The data open to public for the first time is version number as "1". The reason for adding VERSION is that since a released sequence sometimes revised by the submitter, the accession number alone cannot specify the sequence in question causing the user a trouble. The number is increased by one every time when a revised sequence is made public. 2.5. KEYWORDS line The data banks describe this line, if necessary. In many cases, the categories of the data (EST, HTG etc.), gene names and product names included in "KEYWORDS". 2.6. SOURCE line This line shows the scientific name on organism from which the sequence is obtained and an organelle type if the sequence is derived from an organelle other than the nucleus. 2.7. REFERENCE line The information on the submitters and references related to the submitted sequence is indicated in REFERENCE line. 2.8. COMMENT line. The information about an entry that can not be described using FEATURES or the other fields. 2.9. FEATURES line Biological features of a submitted sequence data are described with "Feature" key (the biological nature of the annotated feature), "Location" (the region of the sequence which corresponds to Feature), and "Qualifier" (supplementary information about Feature). The "Feature" and "Qualifier" keys used in the present release is defined by DDBJ/EMBL/GenBank Feature Table: Definition (Version 7.0 October, 2007). The document is continuously updated every half year. You can find its newest version on URL; http://www.ddbj.nig.ac.jp/FT/full_index.html 2.10. BASE COUNT line In the BASE COUNT line of the DDBJ flat file, 9 digits are allocated for each number of a (adenine), c (cytosine), g(guanine) and t (thymine). In the case of RNA sequence, uracil is indicated as "t" according to the rule of the international nucleotide database. In accordance with the relaxation of sequence length limitation, GenBank had already dropped the BASE COUNT line from their flat file format from GenBank Release 138 (Oct. 2003). DDBJ has decided to maintain the BASE COUNT line in our flat file format from the view that GC contents are still important information to characterize the sequence. 2.11. ORIGIN line The sequence data starts from the next line of ORIGIN. The sequence is indicated as lower case letters, delimited by space per 10 bases, starts a new line by 60 bases. The numbers described at left side of lines mean the ordinal number of the top base of the line. 3. Dataset categories There have been a number of genome projects going on worldwide. Among them human genome projects have probably been most productive and yielded a large number of ordinary sequences, huge amounts of genome sequences and EST (expressed sequence tags). Thus, we DDBJ have the human (HUM) division solely for human sequences and the primate (PRI) division for non-human primate sequences, while PRI division of GenBank database contains human sequences too. Note that the other divisions such as EST, GSS, and HTC may also contain human sequences. The present release is divided into 21 categories of organisms and others. See also '6. File categories' and '9. File list' below. The contents of the 21 categories are shown in the following. 3.1. Division categories The first 20 divisions are given below; HUM; human PRI; primates (other than human) ROD; rodents MAM; mammals (other than primates and rodents) VRT; vertebrates (other than mammals) INV; invertebrates (animals other than vertebrates) PLN; plants, fungi, plastids (eukaryotes other than animals) BCT; bacteria (including both Eubacteria and Archaea) VRL; viruses PHG; bacteriophages ENV; sequences obtained via environmental sampling methods SYN; synthetic constructs EST; expressed sequence tags; short single pass cDNA sequences GSS; genome survey sequences; short single pass genomic sequences HTC; high throughput cDNA sequences; The sequence submitted from cDNA sequencing projects except for EST. This division is to include unfinished high throughput cDNA sequences, each of which has 5'UTR and 3'UTR at both ends and part of a coding region. The sequence may also include introns. When the sequence becomes finished later, it moves to the corresponding taxonomic division. HTG; high throughput genomic sequences The sequence submitted mainly from genome sequencing projects which regarded a clone as a sequencing unit. STS; sequence tagged sites The tag site for genome sequencing. The information of chromosome, map, PCR_condition is mandatory for this division. PAT; sequence data related to patent application The data those which the Japanese Patent Office (JPO), United States Patent and Trademark Office (USPTO), the European Patent Office (EPO), and Korean Intellectual Property Office (KIPO) collected, processed and released. See also '3.3. Notice for patent related sequence data' below. UNA; the data not annotated The UNA division is not used for recently submitted sequences. CON; Contig / Constructed To conjugate a series of entries, such as those submitted from a genome project, each of the three data banks constructs an entry and assign an accession number to a large scale sequence dataset. Such entries are classified into the CON division. The entry in the CON division has the information of joined accession numbers instead of the sequence data. The corresponding entries of the CON entry have been submitted to other divisions. The entries and bases in the CON division are not counted in the released numbers given on the top of the release note. 3.2. TPA separated from primary dataset TPA (Third Party Annotation) data are also available. The TPA data are a complement to the existing DDBJ/EMBL/GenBank comprehensive database of primary nucleotide sequences, which typically result from direct sequencing of cDNAs, ESTs, genomic DNAs etc. Primary entries are defined to be data for which the submitting group has done the sequencing and annotation, and as 'owner' of these data has privileges to submit updates/corrections etc. Primary entries used to build a TPA sequence are those that have been experimentally determined and are publicly available in the DDBJ/EMBL/GenBank databases. They may not be from a proprietary database. The entries and bases in TPA are not counted in the released numbers given on the top of the release note. See also the following URLs; http://www.ddbj.nig.ac.jp/sub/tpa-e.html http://www.insdc.org/TPA.html 3.3. Notice for patent related sequence data This release includes PAT division for patent related sequence data as described above. The data those which Japanese Patent Office (JPO), United States Patent and Trademark Office (USPTO), European Patent Office (EPO), and Korean Intellectual Property Office (KIPO) collected, processed and released. The prefixes of accession numbers for the patent related sequence data are shown below; -------------------------- JPO : E, BD, DD, DJ EPO : A, AX, CQ, CS, FB USPTO: I, AR, DZ, EA KIPO : DI -------------------------- Note also that unauthorized use of the patented data may cause legal issues for which DDBJ takes no responsibility. 4. DDBJ staff This release is published by the following DDBJ staff. Gojobori T, Tateno Y, Sugawara H, Saitou N, Okubo K, Ikeo K, Suzuki Y, Fukuchi S, Sumiyama K, Ogasawara O, Ogura A, Minezaki Y, Aono H, Ehara Y, Ejima M, Fukuda D, Furuya H, Gojobori M, Hirai T, Hoshi N, Hosokawa T, Ikesaka T, Ikezawa H, Kawamoto T, Kodachi W, Kodama Y, Kohira J, Koike T, Kosuge T, Kurihara T, Kuroda M, Kusakabe A, Lee K, Maesako H, Maki M, Mamiya H, Mamiya K, Maruyama N, Mashima J, Murakata N, Nagira S, Nagura M, Nishida S, Nishinomiya N, Nozaki A, Okido T, Sakai K, Sugita R, Tanabe W, Tsutsui H, Yamada H, Yamamoto K, Yamamoto M, and Yokoyama E Center for Information Biology and DNA Data Bank of Japan National Institute of Genetics Research Organization of Information and Systems Mishima 411-8540, Japan Phone: +81 55 981 6853 FAX: +81 55 981 6849 E-mail: ddbj@ddbj.nig.ac.jp (for general inquiry) ddbjsub@ddbj.nig.ac.jp (for data submission) ddbjupdt@ddbj.nig.ac.jp (for updates and notification of publication) WWW: http://www.ddbj.nig.ac.jp/ (for DDBJ WWW server) http://sakura.ddbj.nig.ac.jp/ (for DDBJ sequence data submission system) 5. Acknowledgment We are grateful to NCBI and EMBL/EBI for a firm friendship and an excellent collaboration with us. We also thank the Japanese Patent Office for a steady cooperation with us. The operation of DDBJ is supported by the Ministry of Education, Culture, Sports, Science and Technology, and we would gratefully note this here. DDBJ uses the Super-SINET computer network for data collection, data exchange and various services. 6. File categories This release covers 21 categories (see also '3. Dataset categories'.) of organisms and others as follows: ------------------------------------------------------------------------------ ddbjbct*** Category for bacteria ddbjcon*** Category for CON (contig sequences) ddbjenv*** Category for ENV (environmental samples) ddbjest*** Category for EST (expressed sequence tags) ddbjgss*** Category for GSS (genome survey sequences) ddbjhtc*** Category for HTC (high throughput cDNA sequences) ddbjhtg*** Category for HTG (high throughput genomic sequences) ddbjhum*** Category for human ddbjinv*** Category for invertebrates ddbjmam*** Category for mammals other than primates and rodents ddbjpat*** Category for patents ddbjphg*** Category for phages ddbjpln*** Category for plants ddbjpri*** Category for primates other than human ddbjrod*** Category for rodents ddbjsts*** Category for STS (sequence tagged sites) ddbjsyn*** Category for synthetic DNAs ddbjtpa*** Category for TPA (Third Party Annotation) ddbjuna*** Category for unannotated sequences ddbjvrl*** Category for viruses ddbjvrt*** Category for vertebrates other than mammals ------------------------------------------------------------------------------ Some of above in the present release are recorded in multiple ddbj***##.seq files, each of which at most has 1.5 GB storage capacity as follows, respectively. --------------------- ddbjbct : 5 files ddbjenv : 2 files ddbjest : 110 files ddbjgss : 43 files ddbjhtc : 2 files ddbjhtg : 18 files ddbjhum : 5 files ddbjinv : 2 files ddbjpat : 7 files ddbjpln : 5 files ddbjrod : 5 files ddbjsts : 3 files ddbjvrl : 2 files ddbjvrt : 3 files ddbjcon : 14 files --------------------- The index files included in this release are ddbjacc#.idx, ddbjgen.idx, ddbjjou#.idx, and ddbjkey#.idx. See also '9. File list'. All of them except ddbjgen.idx are recorded in multiple ddbj****.idx files, each of which at most has 1.5 GB storage capacity. 7. Sample of the contents in each file 7.1. Part of the contents in the file 'ddbjbct1.seq' This shows all pieces of information on one entry in DDBJ format. ------------------------------------------------------------------------------ LOCUS D87069 993 bp mRNA linear BCT 05-OCT-2006 DEFINITION Escherichia coli mRNA for RNA polymerase sigma subunit, truncated form of sigma-38, complete cds. ACCESSION D87069 VERSION D87069.1 KEYWORDS RNA polymerase sigma subunit, truncated form of sigma-38. SOURCE Escherichia coli ORGANISM Escherichia coli Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; Enterobacteriaceae; Escherichia. REFERENCE 1 (bases 1 to 993) AUTHORS Jishage,M. TITLE Direct Submission JOURNAL Submitted (14-AUG-1996) to the DDBJ/EMBL/GenBank databases. Contact:Miki Jishage National Institute of Genetics, Molecular Genetics; Yata 1111, Mishima, Shizuoka 411, Japan REFERENCE 2 (bases 1 to 993) AUTHORS Jishage,M. and Ishihama,A. TITLE Variation in RNA polymerase sigma subunit composition within different stocks of Escherichia coli starin W3110 JOURNAL Unpublished (1996) REFERENCE 3 AUTHORS Ivanova,A., Renshaw,M., Guntaka,R. and Eisenstark,A. TITLE DNA base sequence variability in katF (putative sigma factor) gene Escherichia coli JOURNAL Nucleic Acids Res. 20, 5479-5480 (1992) REFERENCE 4 AUTHORS Takayanagi,Y., Tanaka,K. and Takahashi,H. TITLE Structure of the 5' upstream region and the regulation of the rpoS gene of Escherichia coli JOURNAL Mol. Gen. Genet. 243, 525-531 (1994) COMMENT FEATURES Location/Qualifiers source 1..993 /db_xref="taxon:562" /mol_type="mRNA" /organism="Escherichia coli" /strain="W3110" CDS 1..810 /note="the gene has four single base changes, resulting in two amino acid substitutions and an amber mutation" /product="RNA polymerase sigma subunit, truncated form of sigma-38" /protein_id="BAA13238.1" /transl_table=11 /translation="MSQNTLKVHDLNEDAEFDENGVEVFDEKALVEYEPSDNDLAEEE LLSQGATQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLV VKIARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMN QTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNER ITSVDTPLGGDSEKALLDILADEKENGPEDTTQDDDMKQSIVKWLFELNAK" variation 75 /citation=[3] /replace="t" variation 97 /citation=[3] /replace="t" variation 99 /citation=[3] /replace="t" variation 808 /citation=[3] /replace="t" BASE COUNT 254 a 223 c 291 g 225 t ORIGIN 1 atgagtcaga atacgctgaa agttcatgat ttaaatgaag atgcggaatt tgatgagaac 61 ggagttgagg tttttgacga aaaggcctta gtagaatatg aacccagtga taacgatttg 121 gccgaagagg aactgttatc gcagggagcc acacagcgtg tgttggacgc gactcagctt 181 taccttggtg agattggtta ttcaccactg ttaacggccg aagaagaagt ttattttgcg 241 cgtcgcgcac tgcgtggaga tgtcgcctct cgccgccgga tgatcgagag taacttgcgt 301 ctggtggtaa aaattgcccg ccgttatggc aatcgtggtc tggcgttgct ggaccttatc 361 gaagagggca acctggggct gatccgcgcg gtagagaagt ttgacccgga acgtggtttc 421 cgcttctcaa catacgcaac ctggtggatt cgccagacga ttgaacgggc gattatgaac 481 caaacccgta ctattcgttt gccgattcac atcgtaaagg agctgaacgt ttacctgcga 541 accgcacgtg agttgtccca taagctggac catgaaccaa gtgcggaaga gatcgcagag 601 caactggata agccagttga tgacgtcagc cgtatgcttc gtcttaacga gcgcattacc 661 tcggtagaca ccccgctggg tggtgattcc gaaaaagcgt tgctggacat cctggccgat 721 gaaaaagaga acggtccgga agataccacg caagatgacg atatgaagca gagcatcgtc 781 aaatggctgt tcgagctgaa cgccaaatag cgtgaagtgc tggcacgtcg attcggtttg 841 ctggggtacg aagcggcaac actggaagat gtaggtcgtg aaattggcct cacccgtgaa 901 cgtgttcgcc agattcaggt tgaaggcctg cgccgtttgc gcgaaatcct gcaaacgcag 961 gggctgaata tcgaagcgct gttccgcgag taa // ------------------------------------------------------------------------------ 7.2. Part of the contents in the accession number index file 'ddbjacc1.idx' The following excerpt from the accession number index file illustrates the format of the index. ------------------------------------------------------------------------------ D00001 ECPBPA BCT X04516 D00002 ECPYRC BCT X04469 D00003 HUMP450M HUM D00003 D00004 FLBFLBL40 VRL D00004 D00005 IBAMEM682 VRL D00005 D00006 BACPNS1981 BCT D00006 D00007 CHKCALGRP VRT D00007 D00008 ECPNTAB BCT X04195 D00009 DROPER1 INV D00009 ------------------------------------------------------------------------------ 7.3. Part of the contents in the keyword phrase index file 'ddbjkey1.idx' Keyword phrases consist of names for gene products and other characteristics of sequence entries. ------------------------------------------------------------------------------ "COAT PROTEIN SMO511347 VRL AJ511347 'TNPA GENE UBA564903 BCT AJ564903 'ZINC-FINGER' MOTIF PRNS53 VRL X60546 (+) MATING TYPE SURFACE PROTEIN ABGPSSP PLN M94861 (1,3 TABETGLUB PLN Z22874 (1,3)-BETA-D-GLUCAN BINDING PROTEIN AJ606470 INV AJ606470 (1,3)BETA-GLUCAN SYNTHASE NCU09275 PLN U09275 (1,4)-BETA-D-ARABINOXYLAN ARABINOFURANOHYDROLASE ANAXHA PLN Z78011 ANTUAXHA PLN Z78010 (1,6)-BETA-GLUCAN BIOSYNTHESIS YSAKRE1A PLN M81588 (1-3)-BETA-GLUCANASE NTSP41AGN PLN X81560 PA13BGPT PLN X57794 (1-3,1-4)-BETA-D-GLUCANASE HVBDG PLN X52572 (1-4)-BETA-MANNAN ENDOHYDROLASE CAR278996 PLN AJ278996 CAR293305 PLN AJ293305 (2',5'-OLIGOISOADENYLATE SYNTHETASE-DEPENDENT) AL138776 HUM AL138776 (2'-5') OLIGO(A) SYNTHASE E16 SSO4G06 EST F14610 (2'-5')OLIGOADENYLATE SYNTHETASE HSA225089 HUM AJ225089 HUMSYN25A HUM D00068 SSA225090 MAM AJ225090 (6')-IB' AMINOGLYCOSIDE ACETYLTRANSFERASE AXY278514 BCT AJ278514 PAE291609 BCT AJ291609 (8,11)-LINOLEOYL DESATURASE COF245938 PLN AJ245938 ------------------------------------------------------------------------------ 7.4. Part of the contents in the journal citation index file 'ddbjjou1.idx' The journal citation index file lists all of the citations that appear in the references. ------------------------------------------------------------------------------ (ER) AAPS PHARMSCI. 4 (3), DOI 10.1208/PS040315 (2002) AY170916 ROD AY170916 (ER) AM. J. HUM. GENET. 76 (1) (2004) IN PRESS AY753209S1 HUM AY753209 AY753209S2 HUM AY753210 (ER) ARCH. VIROL. (2004) IN PRESS AF531505 VRL AF531505 AY518899 VRL AY518899 AY518900 VRL AY518900 AY518901 VRL AY518901 AY518902 VRL AY518902 AY518903 VRL AY518903 AY518904 VRL AY518904 AY518905 VRL AY518905 AY518906 VRL AY518906 AY518907 VRL AY518907 AY518908 VRL AY518908 AY518909 VRL AY518909 AY518910 VRL AY518910 AY518911 VRL AY518911 AY518912 VRL AY518912 AY518913 VRL AY518913 AY518914 VRL AY518914 AY518915 VRL AY518915 AY518916 VRL AY518916 AY518917 VRL AY518917 AY518918 VRL AY518918 AY518919 VRL AY518919 AY518920 VRL AY518920 AY518921 VRL AY518921 AY518922 VRL AY518922 AY518923 VRL AY518923 AY518924 VRL AY518924 AY518925 VRL AY518925 AY518926 VRL AY518926 AY518927 VRL AY518927 AY518928 VRL AY518928 AY518929 VRL AY518929 AY518930 VRL AY518930 AY518931 VRL AY518931 AY518932 VRL AY518932 AY521234 VRL AY521234 AY521235 VRL AY521235 AY521236 VRL AY521236 AY521237 VRL AY521237 AY521238 VRL AY521238 (ER) ARTERIOSCLER. THROMB. VASC. BIOL. (2004) IN PRESS AY563557 HUM AY563557 (ER) BIOCHEM. BIOPHYS. RES. COMMUN. 325 (1), 203-214 (2004) AY563137 HUM AY563137 (ER) BIOCHEM. J./10.1042/BJ20030293 HSA496460 HUM AJ496460 ------------------------------------------------------------------------------ 7.5. Part of the contents in the gene name index file 'ddbjgen.idx' This file lists all the gene names that appear in the feature table. ------------------------------------------------------------------------------ 'ARR BX927156 BCT BX927156 'BGLG BX927156 BCT BX927156 'BGLS BX927148 BCT BX927148 'BGLY' BX927156 BCT BX927156 'BRNQ AF305888 BCT AF305888 'COMK AL591983 BCT AL591983 AL596172 BCT AL596172 'CRCB BX927155 BCT BX927155 'CRTI BX927155 BCT BX927155 'DPPE LDDIPEP BCT Z34898 'FIC BX936398 BCT BX936398 ------------------------------------------------------------------------------ 8. Release history Release Date Entries Bases Comments 73 03/08 83,167,582 86,099,950,395 72 12/07 79,004,098 82,592,245,487 E-mail address deletion 71 09/07 76,273,345 79,706,204,461 70 06/07 72,801,679 76,788,510,646 69 03/07 67,523,680 71,775,679,500 PROJECT line started Indexes for each category terminated 68 12/06 64,267,978 68,259,314,742 1.5 GB storage started 67 09/06 61,144,621 65,443,024,193 66 06/06 58,176,628 62,945,843,881 65 03/06 55,890,995 60,564,721,635 TPA subcategories started 64 12/05 52,272,669 56,098,558,378 Some index files split 63 09/05 47,741,593 52,246,110,341 62 06/05 45,249,444 49,158,155,283 ENV started Version for release note started 61 03/05 43,118,204 47,099,081,750 Changed style of release note 60 12/04 40,583,945 44,416,752,273 /db_xref="H-inv:**" started 59 09/04 37,926,117 42,245,956,937 58 06/04 34,917,581 39,812,635,108 57 03/04 32,693,678 38,008,449,840 56 12/03 30,405,173 36,079,046,032 55 09/03 27,753,140 34,280,225,489 54 06/03 25,149,821 32,162,041,177 53 02/03 23,250,813 29,711,299,332 52 12/02 20,354,812 26,931,456,316 51 09/02 18,401,358 22,782,404,136 TPA started 50 06/02 17,260,693 20,158,357,982 49 04/02 16,503,157 18,579,627,226 48 01/02 15,016,100 16,197,713,855 47 10/01 13,266,610 14,145,671,645 46 07/01 12,313,759 13,037,646,166 45 04/01 11,434,113 12,207,092,905 HTC division started 44 01/01 10,165,597 11,136,298,841 43 10/00 8,666,551 10,034,532,698 42 07/00 7,554,995 8,880,721,093 41 04/00 5,962,608 6,409,581,885 CON division started 40 01/00 5,388,125 4,762,696,173 RNA division terminated 39 10/99 4,810,773 3,728,000,562 NID and PID discarded 38 07/99 4,294,369 3,098,519,597 37 03/99 3,311,627 2,375,261,951 VERSION, /protein_id started 36 01/99 3,073,166 2,190,425,560 35 10/98 2,759,261 1,957,341,169 34 07/98 2,412,785 1,708,580,623 33 04/98 2,174,769 1,479,303,279 32 01/98 1,956,669 1,300,950,613 31 10/97 1,731,532 1,139,869,464 Adoption of the unified taxonomy database 30 07/97 1,534,115 992,788,339 NID and PID terminated 29 04/97 1,270,194 841,415,232 28 01/97 1,154,120 756,785,219 HTG division started ORG division terminated 27 10/96 936,697 608,103,057 GSS division started 26 07/96 835,552 551,932,448 25 04/96 744,490 499,300,364 /translation started 24 01/96 637,508 431,771,652 23 10/95 569,757 390,694,350 22 07/95 437,588 322,982,425 HUM division started 21 04/95 274,596 250,875,023 20 01/95 239,689 231,299,557 19 10/94 204,332 205,274,131 18 07/94 185,230 192,473,021 17 04/94 169,957 179,942,209 16 01/94 154,626 165,017,628 15 10/93 131,649 147,224,690 14 07/93 120,350 138,686,333 13 04/93 112,067 129,784,445 12 01/93 97,683 120,815,244 EST division started 11 07/92 65,693 84,839,075 10 01/92 59,317 77,805,556 GenBank/EMBL inclusion started 9 07/91 1,130 2,002,124 8 01/91 879 1,573,442 7 07/90 681 1,154,211 6 01/90 496 841,236 5 07/89 395 679,378 4 01/89 302 535,985 3 07/88 230 345,850 2 01/88 142 199,392 1 07/87 66 108,970 Started with DDBJ only ------------------ Since release 72 ------------------ Deletion of E-mail address, phone and fax numbers from DDBJ flat file: To follow the Japanese law of protecting personal information, DDBJ deleted both phone and fax numbers, and E-mail address from the flat files of the entries submitted to DDBJ. It would be also helpful to protect DDBJ releases against SPAM mail senders. DDBJ retrofitted most of all entries submitted to DDBJ, not to GenBank or EMBL, by the DDBJ periodical release 72. Previously, the submitter information was described in JOURNAL line at REFERENCE 1 as, -------------------------------------------------------------------------------- REFERENCE 1 (bases 1 to 1200) AUTHORS Mishima,T. TITLE Direct Submission JOURNAL Submitted (01-Jan-1990) to the DDBJ/EMBL/GenBank databases. Taro Mishima, DNA Data Bank of Japan, National Institute of Genetics; 1111, Yata, Mishima, Shizuoka 411-8540, Japan (E-mail:ddbj@ddbj.nig.ac.jp, URL:http://www.ddbj.nig.ac.jp/, Tel:81-12-345-6789, Fax:81-12-345-9876) -------------------------------------------------------------------------------- After the deletion or the information in question, DDBJ flat file is either one of the following two types; Type 1: Phone and fax numbers and E-mail address are deleted. -------------------------------------------------------------------------------- REFERENCE 1 (bases 1 to 1200) AUTHORS Mishima,T. TITLE Direct Submission JOURNAL Submitted (01-Jan-1990) to the DDBJ/EMBL/GenBank databases. Contact:Taro Mishima DNA Data Bank of Japan, National Institute of Genetics; 1111, Yata, Mishima, Shizuoka 411-8540, Japan URL :http://www.ddbj.nig.ac.jp/ ------------------------------------------------------------------------------- Type 2: When the submitters wish to keep their contact information disclosed, it is described as, ------------------------------------------------------------------------------- REFERENCE 1 (bases 1 to 1200) AUTHORS Mishima,T. TITLE Direct Submission JOURNAL Submitted (01-Jan-1990) to the DDBJ/EMBL/GenBank databases. Contact:Taro Mishima DNA Data Bank of Japan, National Institute of Genetics; 1111, Yata, Mishima, Shizuoka 411-8540, Japan URL :http://www.ddbj.nig.ac.jp/ E-mail :ddbj@ddbj.nig.ac.jp Phone :81-12-345-6789 Fax :81-12-345-9876 ------------------------------------------------------------------------------- ------------------ Since release 69 ------------------ Introduction of the project ID at PROJECT line in DDBJ flat file: Following the agreement at the INSD collaborative meeting in 2006, INSDC has started to assign the project ID for submissions from sequencing projects. The description of project ID is shown as below; ---------------------------------------------------------------------------- A unique identifier, assigned at the time of the submission by a sequencing project that informed INSDC of the submission beforehand. It is recommended that the submitter quotes the assigned project ID in all communication with INSDC databases to allow for easier and faster tracking of issues. The project ID field provides an umbrella identifier that points to all related sequence data for the project. ---------------------------------------------------------------------------- The PROJECT lines contain INSDC-assigned ID for the sequencing project. It will be appeared between VERSION and KEYWORDS lines in DDBJ flat files, from the DDBJ periodical release, 69 as shown below. See also '2. DDBJ flat file format'. ---------------------------------------------------------------------------- ACCESSION AB012345 VERSION AB012345.1 PROJECT GenomeProject:123 KEYWORDS . ---------------------------------------------------------------------------- Termination of providing the index files for each category: For users logging in one of our computers (supernig), we provided index files for each category. However, as the computer system in our institute was replaced with a new one which does not have a service using the index files, we terminated providing the index files. ------------------ Since release 68 ------------------ Split of files: We changed the maximum file size from 300 MB to 1.5 GB, because the network capacity has been remarkably increased. Each file named as ddbj***##.seq has at most 1.5 GB storage capacity. See also the sections, '6. File categories' and '9. File list'. ------------------ Since release 65 ------------------ Introduction of two types of TPA entries: According to the decision of ICM 2005, TPA data set is now classified into two categories, "TPA:experimental" and "TPA:inferential", to distinguish TPA annotation supported by wet-lab. experimental evidence and that inferred. The retrofit to divide TPA entries into two categories starts from the release 65. You can find the description of the two TPA categories at the following URLs; http://www.ddbj.nig.ac.jp/sub/tpa-e.html http://www.insdc.org/TPA.html See also '3.2. TPA separated from primary dataset'. ------------------ Since release 64 ------------------ Split of index files: In the present release, some of index files (ddbjacc.idx, ddbjjou.idx, and ddbjkey.idx) have been greater than 2 GB in the file size. So, these have been recorded in multiple ddbj****.idx files, each of which at most has 1.5 GB storage capacity as follows, respectively. See also 6., 7.2., 7.3., 7.4. and 9. ------------------ Since release 62 ------------------ Release version number is introduced: DDBJ has started to include the item, 'version', for its release note, which indicates a version for its periodical release. It is expressed like '62.0', in which the digit(s) after the period is a version number. The reason for adding the version number is that a released data is sometimes revised due to urgent and necessary corrections. The number is increased by one every time when a revised periodical release is made public until the next release. Introduction of ENV division: Recently, the submissions of the sequences derived from environmental samples have rapidly increased. To accommodate such submissions, a new division, ENV, has been created (See also '3.1. Division categories'). This division contains the sequences obtained via direct molecular isolation such as PCR, DGGE, or any anonymous method. In the past, the sequences derived from environmental samples belonged to taxonomic divisions, mainly BCT. At DDBJ, the retrofit to transfer relevant entries from taxonomic divisions to the ENV division starts in the present release, and ends by the next periodical release. Please note that during this transitional period, some entries to be eventually placed in the ENV division will be found in other divisions. Strand information is removed: The strand information of LOCUS line in the flat file has been removed as shown below. See also '2.1. LOCUS line'. ---------------------------------------------------------------------------- Old (-rel. 61): 44-44 space 45-47 spaces, ss- (single-stranded), ds- (double-stranded), or ms- (mixed-stranded) New (rel. 62-): 44-47 spaces ---------------------------------------------------------------------------- ------------------ Since release 61 ------------------ The style of release note (this file) has been changed. Some entries have the sequential format for the secondary accession numbers in the ACCESSION line, in order to make the expression of secondary accession numbers in the past short. For example; ------------------------------------------------------------------------------ Before; ACCESSION AB000802 D85885 D85886 D85887 After; ACCESSION AB000802 D85885-D85887 ------------------------------------------------------------------------------ See also '2.3. ACCESSION line'. ------------------ Since release 60 ------------------ The cross-reference to the H-invitational has been included. ------------------ Since release 56 ------------------ The three data banks have agreed that the maximum length limitation (350 kb) of a submitted sequence be relaxed. The BASE COUNT line of the DDBJ flat file format has been changed, corresponding to the relaxation of the maximum sequence length restriction in the entry that had been practiced at DDBJ/EMBL/GenBank International Nucleotide Sequence Databases. In the BASE COUNT line of the DDBJ flat file, 6 digits had been allocated for each number of a, c, g, t and other bases in the sequence. Hereafter, in the new flat file format, 9 digits are allocated for each number of a, c, g and t, while the numbers of other bases are removed. In accordance with the relaxation of sequence length limitation, GenBank had already dropped the BASE COUNT line from their flat file format from GenBank Release 138 (Oct. 2003). We DDBJ have decided to maintain the BASE COUNT line in our flat file format from the view that GC contents are still important information to characterize the sequence. The changes in the BASE COUNT line are shown below. ---------------------------------------------------------------------------- Old (-rel. 55): 1 6 11 16 21 26 31 36 41 46 51 56 61 66 71 |----|----|----|----|----|----|----|----|----|----|----|----|----|----| BASE COUNT 123456 a 123456 c 123456 g 123456 t 123456 others New (rel. 56-): 1 6 11 16 21 26 31 36 41 46 51 56 61 66 71 |----|----|----|----|----|----|----|----|----|----|----|----|----|----| BASE COUNT 123456789 a 123456789 c 123456789 g 123456789 t ---------------------------------------------------------------------------- The SOURCE in the flat file is revisited and revised if necessary in accordance with the unified taxonomy database common to the three data banks. ------------------ Since release 54 ------------------ '/sequenced_mol' qualifier has been changed to '/mol_type' qualifier. We accordingly completed retrofitting the pertinent entries. This change was made on the agreement at the INSD collaborative meeting in 2002. ------------------ Since release 51 ------------------ The TPA (Third Party Annotation) dataset has been available. The dataset is a complement to the existing DDBJ/EMBL/GenBank database of the primary nucleotide sequences which were obtained from direct sequencing of cDNAs, ESTs, genomic DNAs etc. The format of LOCUS line in the flat file has been changed as shown below to adjust to the GenBank format. ------------------------------------------------------------------------------ Old (-rel. 50): LOCUS AB000001 660 bp DNA PLN 01-FEB-2001 New (rel. 51-): LOCUS AB000001 660 bp DNA linear PLN 01-FEB-2001 ------------------------------------------------------------------------------ ------------------ Since release 45 ------------------ The HTC (High Throughput cDNA) division has been included. This is to include unfinished high throughput cDNA sequences, each of which has 5'UTR and 3'UTR at both ends and part of a coding region. The sequence may also include introns. When the sequence becomes finished later, it moves to the corresponding taxonomic division. The sequence is accompanied with a keyword, HTC (High Throughput cDNA), which is dropped when the sequence is finished and moved to a taxonomic division. ------------------ Since release 41 ------------------ The CON division has been included. This division is to show the order of related sequences in a genome, and expressed by join and the accession numbers of the sequences. The contents of the CON division are compiled by the three data banks not by the data submitter. ------------------ Since release 40 ------------------ The RNA division was terminated. The RNA data have been redistributed according to the category of the organism. Therefore, you will find a human RNA sequence, for example, in the HUM division. ------------------ Since release 37 ------------------ The three data banks include the item VERSION in the flat file, which indicates a version of a submitted nucleotide sequence. It is expressed like AB123456.1, in which the digit(s) after the period is a version number. The reason for adding VERSION is that since a released sequence sometimes revised by the submitter, the accession number alone cannot specify the sequence in question causing the user a trouble. The number is increased by one every time when a revised sequence is made public. Accordingly, the translated protein sequence will be accompanied with a /protein_id which is expressed as BAA12345.1, in which the digit(s) after the period is again a version number. The number is increased by one when the corresponding nucleotide sequence is revised and the protein sequence is changed as a result, and when the revised protein sequence is made public. ------------------ Since release 31 ------------------ We have started adopting the unified taxonomy database to unify the biological source of the sequence. The database is made up with scientific names, ID of unidentified organisms, and synthetic constructs etc. ------------------ Since release 30 ------------------ NID and PID were terminated. This change was made on the agreement at the INSD collaborative meeting in 1999. ------------------ Since release 28 ------------------ The HTG (High Throughput Genomic sequence) has been included. This division was created to cope with genome project teams which deal with a clone as a sequencing unit. We terminated the ORG (Organelle) division. Thus, if you are interested in human mitochondrial sequences, for example, you are now advised to refer to the HUM division. ------------------ Since release 27 ------------------ The GSS division has been included. GSS stands for Genome Survey Sequence, which is similar to EST, except that GSS is genomic DNA whereas EST is cDNA. ------------------ Since release 25 ------------------ DDBJ release contains amino acid sequences that were translated from the corresponding nucleotide sequences of the database. In the translation we paid much attention to the fact that some species or organella have a codon different from the universal one, and used the proper codon table. ------------------ Since release 22 ------------------ The HUM division has been included. Human genome projects have probably been most productive and yielded a large number of sequences Thus, we have the human (HUM) division solely for human sequences and the primate (PRI) division for non-human primate sequences. ------------------ Since release 12 ------------------ The EST (Expressed Sequence Tag) division has been included. The number of ESTs has been increasing at an enormous rate and is expected to be growing even more rapidly in the future. Thus, we created a division for ESTs ------------------ Since release 10 ------------------ The sequences submitted to GenBank or EMBL have been included in the release. 9. File list The files in this release are arranged in the following order with non-labeled format. ----------------------------------------------------------------------- file name file size ----------------------------------------------------------------------- ddbjrel.txt (DDBJ release note) 65996 ddbjacc1.idx (Accession number index file 1) 1499999996 ddbjacc2.idx (Accession number index file 2) 1500000014 ddbjacc3.idx (Accession number index file 3) 244411799 ddbjgen.idx (Gene name index file) 119218910 ddbjjou1.idx (Journal citation index file 1) 1489385731 ddbjjou2.idx (Journal citation index file 2) 1305179219 ddbjjou3.idx (Journal citation index file 3) 751890997 ddbjkey1.idx (Keyword phrase index file 1) 419463117 ddbjkey2.idx (Keyword phrase index file 2) 1425278855 ddbjkey3.idx (Keyword phrase index file 3) 1447053205 ddbjkey4.idx (Keyword phrase index file 4) 146925270 ----------------------------------------------------------------------- file name number of entries number of bases file size ----------------------------------------------------------------------- ddbjbct1.seq 121014 611998152 1501581401 ddbjbct2.seq 87563 639233326 1502906628 ddbjbct3.seq 323 676533461 1502316505 ddbjbct4.seq 5624 653352482 1499001083 ddbjbct5.seq 151130 204647895 603794806 ddbjenv1.seq 591429 390551526 1499001733 ddbjenv2.seq 123373 99520773 334983586 ddbjest1.seq 462723 173137934 1499000070 ddbjest2.seq 490566 191916952 1499000858 ddbjest3.seq 497910 205901739 1499002600 ddbjest4.seq 480018 204849956 1498999982 ddbjest5.seq 549342 296600335 1499001868 ddbjest6.seq 561648 339136777 1499002829 ddbjest7.seq 557226 297760945 1499000459 ddbjest8.seq 338490 93808612 1499000717 ddbjest9.seq 539546 243807144 1499000983 ddbjest10.seq 503668 225703150 1499000948 ddbjest11.seq 465372 195200464 1499000003 ddbjest12.seq 329910 114712109 1499005242 ddbjest13.seq 271033 83182973 1499003546 ddbjest14.seq 271464 110678317 1499001437 ddbjest15.seq 406398 186434386 1499002199 ddbjest16.seq 480219 253965261 1499000136 ddbjest17.seq 463166 253169402 1499000230 ddbjest18.seq 448636 241606198 1499000748 ddbjest19.seq 459164 220594692 1499001069 ddbjest20.seq 467468 287295980 1499000050 ddbjest21.seq 476850 275030131 1499001130 ddbjest22.seq 459693 250677275 1499001582 ddbjest23.seq 447636 266657142 1499004014 ddbjest24.seq 535831 291540407 1498999963 ddbjest25.seq 526160 308646176 1499001268 ddbjest26.seq 402853 202072225 1499002222 ddbjest27.seq 438790 261327852 1499001362 ddbjest28.seq 485356 274832325 1499002991 ddbjest29.seq 518742 249320477 1499000645 ddbjest30.seq 448590 237904916 1499001269 ddbjest31.seq 450615 264297899 1499001298 ddbjest32.seq 438693 300793674 1499001544 ddbjest33.seq 408697 279483717 1499003029 ddbjest34.seq 548644 330503517 1498999997 ddbjest35.seq 619483 340228536 1499001747 ddbjest36.seq 451972 299517886 1499001137 ddbjest37.seq 362272 203199788 1499000156 ddbjest38.seq 255636 96625996 1499000727 ddbjest39.seq 253287 104760237 1499004159 ddbjest40.seq 380245 184805432 1499001773 ddbjest41.seq 444901 270252192 1499002872 ddbjest42.seq 480527 256571945 1499000969 ddbjest43.seq 444610 244052883 1499000508 ddbjest44.seq 540854 303593007 1499000254 ddbjest45.seq 444865 243554776 1499002920 ddbjest46.seq 479927 273732849 1499001817 ddbjest47.seq 536454 274113632 1499002786 ddbjest48.seq 419276 255051403 1499000101 ddbjest49.seq 328620 174756113 1499003177 ddbjest50.seq 263679 123931341 1499001841 ddbjest51.seq 267514 105596975 1499003822 ddbjest52.seq 338344 153312352 1499003266 ddbjest53.seq 495943 301596683 1499001818 ddbjest54.seq 501054 305965838 1499003067 ddbjest55.seq 432517 255362039 1499003277 ddbjest56.seq 441839 253370862 1499002155 ddbjest57.seq 478635 275011355 1499002029 ddbjest58.seq 453630 255569423 1499002795 ddbjest59.seq 433914 250969547 1499002715 ddbjest60.seq 445261 258505390 1499003302 ddbjest61.seq 485382 293051940 1499000595 ddbjest62.seq 492945 322867133 1499000946 ddbjest63.seq 444497 227102085 1499000792 ddbjest64.seq 442440 275052549 1499002732 ddbjest65.seq 427097 273989047 1499000188 ddbjest66.seq 381657 251959422 1499003933 ddbjest67.seq 443518 241426204 1499002491 ddbjest68.seq 419428 234809128 1499001530 ddbjest69.seq 426862 235708255 1499003193 ddbjest70.seq 433917 232545519 1499001169 ddbjest71.seq 530695 314075528 1499001802 ddbjest72.seq 447412 299884047 1499001631 ddbjest73.seq 493413 291085510 1499004276 ddbjest74.seq 397308 294796411 1499003523 ddbjest75.seq 489535 296862830 1499002081 ddbjest76.seq 378682 271072784 1499003313 ddbjest77.seq 393881 266177014 1499001871 ddbjest78.seq 371980 256875426 1499003007 ddbjest79.seq 417357 335283537 1499001160 ddbjest80.seq 460647 288712638 1499002215 ddbjest81.seq 479047 325687024 1499002310 ddbjest82.seq 536296 296528090 1499000057 ddbjest83.seq 534421 205865493 1499000750 ddbjest84.seq 511172 307844955 1499003121 ddbjest85.seq 488596 325310150 1499001902 ddbjest86.seq 516478 307360004 1499000161 ddbjest87.seq 674395 325833661 1499002707 ddbjest88.seq 562201 247844997 1499003030 ddbjest89.seq 469498 303175761 1499001109 ddbjest90.seq 525994 311183318 1499003200 ddbjest91.seq 567700 181880379 1499001186 ddbjest92.seq 523098 333737721 1499000617 ddbjest93.seq 451779 255392521 1499000627 ddbjest94.seq 524660 209778054 1499001736 ddbjest95.seq 575801 226305203 1499000273 ddbjest96.seq 565069 219448248 1499002380 ddbjest97.seq 486697 290714463 1499002337 ddbjest98.seq 500672 333708655 1499003223 ddbjest99.seq 510748 301420744 1499001695 ddbjest100.seq 600261 225872997 1499000620 ddbjest101.seq 558607 292159849 1499000616 ddbjest102.seq 429010 275939448 1499001472 ddbjest103.seq 485019 288322908 1499001487 ddbjest104.seq 443988 300851491 1499003105 ddbjest105.seq 427979 273199244 1499003074 ddbjest106.seq 407326 273799946 1499001138 ddbjest107.seq 429388 296391659 1499001025 ddbjest108.seq 426148 267239529 1499002414 ddbjest109.seq 472103 170799506 1499001405 ddbjest110.seq 62192 23070276 195935310 ddbjgss1.seq 482906 349420080 1499003220 ddbjgss2.seq 449146 341798484 1499001447 ddbjgss3.seq 447292 336752648 1499001545 ddbjgss4.seq 565251 272409508 1499001613 ddbjgss5.seq 487120 251866663 1499000030 ddbjgss6.seq 464874 255071042 1499002971 ddbjgss7.seq 387616 192411566 1499000930 ddbjgss8.seq 421040 212762301 1499002016 ddbjgss9.seq 502113 294086225 1499001467 ddbjgss10.seq 556417 309938288 1499001510 ddbjgss11.seq 495220 292503142 1499000799 ddbjgss12.seq 534719 348388950 1499002703 ddbjgss13.seq 525658 371183016 1499001397 ddbjgss14.seq 515192 353942078 1499000959 ddbjgss15.seq 608907 339252860 1499002386 ddbjgss16.seq 604081 374623652 1499001276 ddbjgss17.seq 566016 311450510 1499002521 ddbjgss18.seq 523912 377494402 1498999938 ddbjgss19.seq 514350 346272989 1499002664 ddbjgss20.seq 605780 386955342 1499000030 ddbjgss21.seq 583837 416858459 1499001383 ddbjgss22.seq 563211 337361675 1499001251 ddbjgss23.seq 493116 312487012 1499000176 ddbjgss24.seq 534021 338381654 1499000522 ddbjgss25.seq 539254 345347817 1499000983 ddbjgss26.seq 536452 329841265 1499000792 ddbjgss27.seq 552880 276794518 1499000893 ddbjgss28.seq 500271 355047238 1499000665 ddbjgss29.seq 478936 348225050 1499000661 ddbjgss30.seq 534232 375923774 1499000382 ddbjgss31.seq 581256 358201535 1499003100 ddbjgss32.seq 456363 343185925 1499000827 ddbjgss33.seq 535477 360758189 1499002481 ddbjgss34.seq 504081 237876548 1499002257 ddbjgss35.seq 582275 304335684 1499002522 ddbjgss36.seq 416574 313450969 1499001499 ddbjgss37.seq 413185 338031083 1499003263 ddbjgss38.seq 429620 350817980 1499000017 ddbjgss39.seq 415180 333017815 1499000187 ddbjgss40.seq 427841 348952856 1499002467 ddbjgss41.seq 424660 349497946 1499001766 ddbjgss42.seq 416168 336969291 1499000181 ddbjgss43.seq 522404 342915264 1466835265 ddbjhtc1.seq 285200 354318652 1499000402 ddbjhtc2.seq 236885 241313579 837350595 ddbjhtg1.seq 11402 1118404302 1499217372 ddbjhtg2.seq 7562 1118501135 1499287997 ddbjhtg3.seq 5891 1131021081 1499210337 ddbjhtg4.seq 5461 1140262106 1499249251 ddbjhtg5.seq 5296 1144525417 1499319056 ddbjhtg6.seq 5330 1144424932 1499106750 ddbjhtg7.seq 6523 1132858278 1499128672 ddbjhtg8.seq 6888 1141689790 1499010518 ddbjhtg9.seq 5885 1136940314 1499272035 ddbjhtg10.seq 6148 1131736627 1499284301 ddbjhtg11.seq 6535 1126397703 1499103263 ddbjhtg12.seq 7469 1116796734 1499077271 ddbjhtg13.seq 6929 1144521822 1499056637 ddbjhtg14.seq 7175 1139280081 1499216943 ddbjhtg15.seq 7061 1148703520 1499027189 ddbjhtg16.seq 7738 1146608174 1499000507 ddbjhtg17.seq 6116 1132213511 1499097256 ddbjhtg18.seq 5614 863800773 1126089225 ddbjhum1.seq 27251 1052683950 1499170231 ddbjhum2.seq 8125 1069616134 1499188026 ddbjhum3.seq 134097 859378928 1499093772 ddbjhum4.seq 59178 1012873510 1499000888 ddbjhum5.seq 214177 426096507 1158909754 ddbjinv1.seq 214894 722984293 1499001509 ddbjinv2.seq 358883 398972062 1276693642 ddbjmam.seq 156645 386719505 837786697 ddbjpat1.seq 1035367 520044358 1499000749 ddbjpat2.seq 776824 494060087 1499000692 ddbjpat3.seq 744992 347190207 1499000532 ddbjpat4.seq 689600 609008031 1499000406 ddbjpat5.seq 740076 379341440 1499003889 ddbjpat6.seq 847734 495520755 1499000434 ddbjpat7.seq 181433 22844316 195072706 ddbjphg.seq 3708 26790114 65656931 ddbjpln1.seq 183805 819390341 1499007191 ddbjpln2.seq 179124 657300416 1499007595 ddbjpln3.seq 35674 957333996 1499071740 ddbjpln4.seq 339785 546111429 1499001019 ddbjpln5.seq 297107 279407388 952214424 ddbjpri.seq 62350 1028098676 1460236419 ddbjrod1.seq 33830 1021235743 1499211831 ddbjrod2.seq 5908 1093920653 1499194062 ddbjrod3.seq 41057 1054454727 1499233791 ddbjrod4.seq 109309 895280458 1499001015 ddbjrod5.seq 157194 61212520 341521423 ddbjsts1.seq 422251 210778300 1499001570 ddbjsts2.seq 339642 239116466 1499000950 ddbjsts3.seq 171360 75383671 498649487 ddbjsyn.seq 64817 94117052 330543732 ddbjuna.seq 275 475858 1351724 ddbjvrl1.seq 398829 403358137 1499001465 ddbjvrl2.seq 133828 132028491 488522137 ddbjvrt1.seq 237902 687371636 1499142084 ddbjvrt2.seq 34464 1106130011 1499072476 ddbjvrt3.seq 152247 233737950 612075564 ------------------------------------------------------------------------------ Total 83167582 86099950395 309600358851 ddbjtpa.seq 5826 22262793 47332024 ddbjcon1.seq 318009 0 1499004598 ddbjcon2.seq 383606 0 1499000001 ddbjcon3.seq 276476 0 1499001542 ddbjcon4.seq 233889 0 1499005141 ddbjcon5.seq 276605 0 1499003038 ddbjcon6.seq 265908 0 1499002678 ddbjcon7.seq 334282 0 1499001856 ddbjcon8.seq 407754 0 1499000347 ddbjcon9.seq 288544 0 1499000869 ddbjcon10.seq 345467 0 1499002441 ddbjcon11.seq 349859 0 1499000149 ddbjcon12.seq 302774 0 1499002934 ddbjcon13.seq 313460 0 1499002650 ddbjcon14.seq 166011 0 1242896329 The entries and bases in the CON division and TPA dataset are not counted in the numbers given on the top of the release note or 'Total' on the above table.