DNA Data Bank of Japan DNA Database Release 76.0, Dec. 2008, including 98,220,409 entries, 98,741,908,446 bases Last published date in the present release: November 28, 2008 ------------------------------------------------------------------------------- Table of contents ------------------------------------------------------------------------------- 1. Introduction 1.1. Announcement for changes in the present release 1.2. Announcement for the forthcoming changes 2. DDBJ flat file format 2.1. LOCUS line 2.2. DEFINITION line 2.3. ACCESSION line 2.4. VERSION line 2.5. KEYWORDS line 2.6. SOURCE line 2.7. REFERENCE line 2.8. COMMENT line 2.9. FEATURES line 2.10. BASE COUNT line 2.11. ORIGIN line 3. Dataset categories 3.1. Division categories 3.2. TPA separated from primary dataset 3.3. Notice for patent related sequence data 4. DDBJ staff 5. Acknowledgment 6. File categories 7. Sample of the contents in each file 7.1. Part of the contents in the file 'ddbjbct1.seq' 7.2. Part of the contents in the accession number index file 'ddbjacc1.idx' 7.3. Part of the contents in the keyword phrase index file 'ddbjkey1.idx' 7.4. Part of the contents in the journal citation index file 'ddbjjou1.idx' 7.5. Part of the contents in the gene name index 'ddbjgen.idx' 8. Release history 9. File list ------------------------------------------------------------------------------- 1. Introduction This database contains nucleotide sequence data for any organism, not only those with DNA genomes but also those with RNA genomes. This database may be copied and redistributed without permission on the condition that all the statements in this release note are reproduced in each copy. See also '3.3. Notice for patented data' below. The present release contains the newest data prepared by the DNA Data Bank of Japan (DDBJ), GenBank (*), and EMBL-Bank/European Bioinformatics Institute (EMBL/EBI) as of November 28, 2008. This unified database was made possible thanks to the international collaboration among the three data banks. All the entries have accordingly been annotated using the feature keys common to them. *'GenBank' is a trademark of NIH, USA, and is operated by National Center for Biotechnology Information (NCBI) at NIH. 1.1. Announcement for changes in the present release Revision of the DDBJ/EMBL/GenBank Feature Table: Definition: Following the agreement at the INSD collaborative meeting in 2008, the document, DDBJ/EMBL/GenBank Feature Table: Definition, was revised in October, 2008. See also '2.9. FEATURES line' below. The revised points are introduced on the following URL; http://www.ddbj.nig.ac.jp/insdc/icm2008-e.html#ft 1.2. Announcement for the forthcoming changes Nothing particular. 2. DDBJ flat file format The database is a collection of "entry" which is the unit of the data. The entries submitted to databanks were processed and publicized according to the DDBJ format for distribution (flat file). The flat file includes the sequence and the information of submitters, references, source organisms, and "feature" information, etc. The items of the DDBJ flat file are explained at following; ------------------------------------------------------------------------------- LOCUS AB000000 450 bp mRNA linear HUM 08-JUL-2002 DEFINITION Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds. ACCESSION AB000000 VERSION AB000000.1 KEYWORDS . SOURCE Homo sapiens ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 450) AUTHORS Mishima,H. and Shizuoka,T. TITLE Direct Submission JOURNAL Submitted (30-NOV-2000) to the DDBJ/EMBL/GenBank databases. Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; 1111, Yata, Mishima, Shizuoka 411-8540, Japan REFERENCE 2 (sites) AUTHORS Mishima,H., Shizuoka,T. and Fuji,I. TITLE Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver JOURNAL Unpublished (2002) COMMENT Human cDNA sequencing project. FEATURES Location/Qualifiers source 1..450 /chromosome="12" /clone="GT200015" /clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)" /map="12p13" /mol_type="mRNA" /organism="Homo sapiens" /tissue_type="liver" CDS 86..>450 /codon_start=1 /gene="GAPD" /product="glyceraldehyde-3-phosphate dehydrogenase" /protein_id="BAA12345.1" /transl_table=1 /translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV" BASE COUNT 102 a 119 c 131 g 98 t ORIGIN 1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct 61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg 121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc 181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt 241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg 301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac 361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc 421 tcaacttaag ggtggtgcta agaaggtctg // ------------------------------------------------------------------------------- 2.1. LOCUS line The format of LOCUS line in the flat file is shown below; --------- -------- Positions Contents --------- -------- 01-05 'LOCUS' 06-12 spaces 13-28 Locus name 29-29 space 30-40 Length of sequence, right-justified 41-41 space 42-43 'bp' 44-47 spaces 48-54 DNA, RNA, mRNA, rRNA, tRNA, left justified 55-55 space 56-63 'linear' followed by two spaces, or 'circular' 64-64 space 65-67 The division code (see '3.1. Division categories') 68-68 space 69-79 Date, in the form dd-MMM-yyyy (e.g., 08-JUL-2002) ------------------------------------------------------------------------------ 2.2. DEFINITION line The definition briefly describes the information of gene(s). "DEFINITION" is constructed by each of the three data banks. 2.3. ACCESSION line This line shows accession number of the entry data. A unique accession number is issued to the data submitter by each of the three data banks. The accession number is composed of 1 alphabet character and 5 digits (ex. A12345) or 2 alphabet characters and 6 digits (ex. AB123456). The former style was used in 1980s, but later the latter style was introduced because of data explosion. All the entries designated by the accession numbers with the prefixes given below have been collected and processed by DDBJ, and the rest have been done by GenBank and EMBL/EBI. ------------------------------------------------------------------------------- C, D, E, AB, AG, AK, AP, AT, AU, AV, BA, BB, BD, BJ, BP, BR, BS, BW, BY, CI, CJ, DA, DB, DC, DD, DE, DF, DG, DH, DI, DJ, DK, DL ------------------------------------------------------------------------------- You can find the list of the prefixes of the accession numbers at the following URL; http://www.ddbj.nig.ac.jp/sub/prefix.html If multiple entries are united to an entry, or if an entry is extensively modified after the submission, the responsible data banks may assign a new accession number to it. In these cases, the new accession number is called the primary accession number, and the old accession number(s) is/are called the secondary accession number(s). In the flat file, the primary accession number is indicated first, then the secondary accession number(s) follows. You can find the same updated entry with both the primary and the secondary accession numbers. 2.4. VERSION line This line consists of an accession number and a version number, like "AB123456.1", in which the digit(s) after the period is a version number. The data open to public for the first time is version number as "1". The reason for adding VERSION is that since a released sequence sometimes revised by the submitter, the accession number alone cannot specify the sequence in question causing the user a trouble. The number is increased by one every time when a revised sequence is made public. 2.5. KEYWORDS line The data banks describe this line, if necessary. In many cases, the categories of the data (EST, HTG etc.), gene names and product names included in "KEYWORDS". 2.6. SOURCE line This line shows the scientific name on organism from which the sequence is obtained and an organelle type if the sequence is derived from an organelle other than the nucleus. 2.7. REFERENCE line The information on the submitters and references related to the submitted sequence is indicated in REFERENCE line. 2.8. COMMENT line. The information about an entry that can not be described using FEATURES or the other fields. 2.9. FEATURES line Biological features of a submitted sequence data are described with "Feature" key (the biological nature of the annotated feature), "Location" (the region of the sequence which corresponds to Feature), and "Qualifier" (supplementary information about Feature). The "Feature" and "Qualifier" keys used in the present release is defined by DDBJ/EMBL/GenBank Feature Table: Definition (Version 8.0 October, 2008). The document is continuously updated every half year. You can find its newest version on URL; http://www.ddbj.nig.ac.jp/FT/full_index.html 2.10. BASE COUNT line In the BASE COUNT line of the DDBJ flat file, 9 digits are allocated for each number of a (adenine), c (cytosine), g(guanine) and t (thymine). In the case of RNA sequence, uracil is indicated as "t" according to the rule of the international nucleotide database. In accordance with the relaxation of sequence length limitation, GenBank had already dropped the BASE COUNT line from their flat file format from GenBank Release 138 (Oct. 2003). DDBJ has decided to maintain the BASE COUNT line in our flat file format from the view that GC contents are still important information to characterize the sequence. 2.11. ORIGIN line The sequence data starts from the next line of ORIGIN. The sequence is indicated as lower case letters, delimited by space per 10 bases, starts a new line by 60 bases. The numbers described at left side of lines mean the ordinal number of the top base of the line. 3. Dataset categories There have been a number of genome projects going on worldwide. Among them human genome projects have probably been most productive and yielded a large number of ordinary sequences, huge amounts of genome sequences and EST (expressed sequence tags). Thus, we DDBJ have the human (HUM) division solely for human sequences and the primate (PRI) division for non-human primate sequences, while PRI division of GenBank database contains human sequences too. Note that the other divisions such as EST, GSS, and HTC may also contain human sequences. The present release is divided into 22 categories of organisms and others. See also '6. File categories' and '9. File list' below. The contents of the 21 categories are shown in the following. 3.1. Division categories The first 21 divisions are given below; HUM; human PRI; primates (other than human) ROD; rodents MAM; mammals (other than primates and rodents) VRT; vertebrates (other than mammals) INV; invertebrates (animals other than vertebrates) PLN; plants, fungi, plastids (eukaryotes other than animals) BCT; bacteria (including both Eubacteria and Archaea) VRL; viruses PHG; bacteriophages ENV; sequences obtained via environmental sampling methods SYN; synthetic constructs EST; expressed sequence tags; short single pass cDNA sequences GSS; genome survey sequences; short single pass genomic sequences TSA; transcriptome shotgun assemblies HTC; high throughput cDNA sequences; The sequence submitted from cDNA sequencing projects except for EST. This division is to include unfinished high throughput cDNA sequences, each of which has 5'UTR and 3'UTR at both ends and part of a coding region. The sequence may also include introns. When the sequence becomes finished later, it moves to the corresponding taxonomic division. HTG; high throughput genomic sequences The sequence submitted mainly from genome sequencing projects which regarded a clone as a sequencing unit. STS; sequence tagged sites The tag site for genome sequencing. The information of chromosome, map, PCR_condition is mandatory for this division. PAT; sequence data related to patent application The data those which the Japanese Patent Office (JPO), United States Patent and Trademark Office (USPTO), the European Patent Office (EPO), and Korean Intellectual Property Office (KIPO) collected, processed and released. See also '3.3. Notice for patent related sequence data' below. UNA; the data not annotated The UNA division is not used for recently submitted sequences. CON; Contig / Constructed To conjugate a series of entries, such as those submitted from a genome project, each of the three data banks constructs an entry and assign an accession number to a large scale sequence dataset. Such entries are classified into the CON division. The entry in the CON division has the information of joined accession numbers instead of the sequence data. The corresponding entries of the CON entry have been submitted to other divisions. The entries and bases in the CON division are not counted in the released numbers given on the top of the release note. 3.2. TPA separated from primary dataset TPA (Third Party Annotation) data are also available. The TPA data are a complement to the existing DDBJ/EMBL/GenBank comprehensive database of primary nucleotide sequences, which typically result from direct sequencing of cDNAs, ESTs, genomic DNAs etc. Primary entries are defined to be data for which the submitting group has done the sequencing and annotation, and as 'owner' of these data has privileges to submit updates/corrections etc. Primary entries used to build a TPA sequence are those that have been experimentally determined and are publicly available in the DDBJ/EMBL/GenBank databases. They may not be from a proprietary database. The entries and bases in TPA are not counted in the released numbers given on the top of the release note. See also the following URLs; http://www.ddbj.nig.ac.jp/sub/tpa-e.html http://www.insdc.org/TPA.html 3.3. Notice for patent related sequence data This release includes PAT division for patent related sequence data as described above. The data those which Japanese Patent Office (JPO), United States Patent and Trademark Office (USPTO), European Patent Office (EPO), and Korean Intellectual Property Office (KIPO) collected, processed and released. The prefixes of accession numbers for the patent related sequence data are shown below; ------------------------------- JPO : E, BD, DD, DJ, DL KIPO : DI USPTO: I, AR, DZ, EA, GC EPO : A, AX, CQ, CS, FB, GM ------------------------------- Note also that unauthorized use of the patented data may cause legal issues for which DDBJ takes no responsibility. 4. DDBJ staff This release is published by the following DDBJ staff. Gojobori T, Tateno Y, Sugawara H, Saitou N, Okubo K, Ikeo K, Suzuki Y, Fukuchi S, Sumiyama K, Ogasawara O, Aono H, Ehara Y, Ejima M, Fukuda D, Gojobori M, Hirai T, Hoshi N, Hosokawa T, Ikesaka T, Ikezawa H, Iwazaki H, Kawahara S, Kawamoto T, Kazama T, Kodachi W, Kodama Y, Kohira J, Koike T, Kosuge T, Kurihara T, Kusakabe A, Lee K, Maki M, Mamiya H, Mashima J, Murakata N, Nagai I, Nagira S, Nagura M, Nakanishi T, Nozaki A, Okido T, Sakai K, Sugita R, Takashima E, Tanabe W, Tsutsui H, Yamada H, Yamamoto K, Yamamoto M, and Yokoyama E Center for Information Biology and DNA Data Bank of Japan National Institute of Genetics Research Organization of Information and Systems Mishima 411-8540, Japan Phone: +81 55 981 6853 FAX: +81 55 981 6849 E-mail: ddbj@ddbj.nig.ac.jp (for general inquiry) ddbjsub@ddbj.nig.ac.jp (for data submission) ddbjupdt@ddbj.nig.ac.jp (for updates and notification of publication) WWW: http://www.ddbj.nig.ac.jp/ (for DDBJ WWW server) http://sakura.ddbj.nig.ac.jp/ (for DDBJ sequence data submission system) 5. Acknowledgment We are grateful to NCBI and EMBL/EBI for a firm friendship and an excellent collaboration with us. We also thank the Japanese Patent Office for a steady cooperation with us. The operation of DDBJ is supported by the Ministry of Education, Culture, Sports, Science and Technology, and we would gratefully note this here. DDBJ uses the Super-SINET computer network for data collection, data exchange and various services. 6. File categories This release covers 21 categories (see also '3. Dataset categories'.) of organisms and others as follows: ------------------------------------------------------------------------------ ddbjbct*** Category for bacteria ddbjcon*** Category for CON (contig sequences) ddbjenv*** Category for ENV (environmental samples) ddbjest*** Category for EST (expressed sequence tags) ddbjgss*** Category for GSS (genome survey sequences) ddbjhtc*** Category for HTC (high throughput cDNA sequences) ddbjhtg*** Category for HTG (high throughput genomic sequences) ddbjhum*** Category for human ddbjinv*** Category for invertebrates ddbjmam*** Category for mammals other than primates and rodents ddbjpat*** Category for patents ddbjphg*** Category for phages ddbjpln*** Category for plants ddbjpri*** Category for primates other than human ddbjrod*** Category for rodents ddbjsts*** Category for STS (sequence tagged sites) ddbjsyn*** Category for synthetic DNAs ddbjtpa*** Category for TPA (third party annotation) ddbjtsa*** Category for TSA (transcriptome shotgun assemblies) ddbjuna*** Category for unannotated sequences ddbjvrl*** Category for viruses ddbjvrt*** Category for vertebrates other than mammals ------------------------------------------------------------------------------ Some of above in the present release are recorded in multiple ddbj***##.seq files, each of which at most has 1.5 GB storage capacity as follows, respectively. --------------------- ddbjbct : 6 files ddbjenv : 2 files ddbjest : 128 files ddbjgss : 49 files ddbjhtc : 2 files ddbjhtg : 21 files ddbjhum : 5 files ddbjinv : 3 files ddbjpat : 9 files ddbjpln : 6 files ddbjpri : 2 files ddbjrod : 5 files ddbjsts : 3 files ddbjvrl : 2 files ddbjvrt : 3 files ddbjcon : 18 files --------------------- The index files included in this release are ddbjacc#.idx, ddbjgen.idx, ddbjjou#.idx, and ddbjkey#.idx. See also '9. File list'. All of them except ddbjgen.idx are recorded in multiple ddbj****.idx files, each of which at most has 1.5 GB storage capacity. 7. Sample of the contents in each file 7.1. Part of the contents in the file 'ddbjbct1.seq' This shows all pieces of information on one entry in DDBJ format. ------------------------------------------------------------------------------ LOCUS D87069 993 bp mRNA linear BCT 05-OCT-2006 DEFINITION Escherichia coli mRNA for RNA polymerase sigma subunit, truncated form of sigma-38, complete cds. ACCESSION D87069 VERSION D87069.1 KEYWORDS RNA polymerase sigma subunit, truncated form of sigma-38. SOURCE Escherichia coli ORGANISM Escherichia coli Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; Enterobacteriaceae; Escherichia. REFERENCE 1 (bases 1 to 993) AUTHORS Jishage,M. TITLE Direct Submission JOURNAL Submitted (14-AUG-1996) to the DDBJ/EMBL/GenBank databases. Contact:Miki Jishage National Institute of Genetics, Molecular Genetics; Yata 1111, Mishima, Shizuoka 411, Japan REFERENCE 2 (bases 1 to 993) AUTHORS Jishage,M. and Ishihama,A. TITLE Variation in RNA polymerase sigma subunit composition within different stocks of Escherichia coli starin W3110 JOURNAL Unpublished (1996) REFERENCE 3 AUTHORS Ivanova,A., Renshaw,M., Guntaka,R. and Eisenstark,A. TITLE DNA base sequence variability in katF (putative sigma factor) gene Escherichia coli JOURNAL Nucleic Acids Res. 20, 5479-5480 (1992) REFERENCE 4 AUTHORS Takayanagi,Y., Tanaka,K. and Takahashi,H. TITLE Structure of the 5' upstream region and the regulation of the rpoS gene of Escherichia coli JOURNAL Mol. Gen. Genet. 243, 525-531 (1994) COMMENT FEATURES Location/Qualifiers source 1..993 /db_xref="taxon:562" /mol_type="mRNA" /organism="Escherichia coli" /strain="W3110" CDS 1..810 /note="the gene has four single base changes, resulting in two amino acid substitutions and an amber mutation" /product="RNA polymerase sigma subunit, truncated form of sigma-38" /protein_id="BAA13238.1" /transl_table=11 /translation="MSQNTLKVHDLNEDAEFDENGVEVFDEKALVEYEPSDNDLAEEE LLSQGATQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLV VKIARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMN QTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNER ITSVDTPLGGDSEKALLDILADEKENGPEDTTQDDDMKQSIVKWLFELNAK" variation 75 /citation=[3] /replace="t" variation 97 /citation=[3] /replace="t" variation 99 /citation=[3] /replace="t" variation 808 /citation=[3] /replace="t" BASE COUNT 254 a 223 c 291 g 225 t ORIGIN 1 atgagtcaga atacgctgaa agttcatgat ttaaatgaag atgcggaatt tgatgagaac 61 ggagttgagg tttttgacga aaaggcctta gtagaatatg aacccagtga taacgatttg 121 gccgaagagg aactgttatc gcagggagcc acacagcgtg tgttggacgc gactcagctt 181 taccttggtg agattggtta ttcaccactg ttaacggccg aagaagaagt ttattttgcg 241 cgtcgcgcac tgcgtggaga tgtcgcctct cgccgccgga tgatcgagag taacttgcgt 301 ctggtggtaa aaattgcccg ccgttatggc aatcgtggtc tggcgttgct ggaccttatc 361 gaagagggca acctggggct gatccgcgcg gtagagaagt ttgacccgga acgtggtttc 421 cgcttctcaa catacgcaac ctggtggatt cgccagacga ttgaacgggc gattatgaac 481 caaacccgta ctattcgttt gccgattcac atcgtaaagg agctgaacgt ttacctgcga 541 accgcacgtg agttgtccca taagctggac catgaaccaa gtgcggaaga gatcgcagag 601 caactggata agccagttga tgacgtcagc cgtatgcttc gtcttaacga gcgcattacc 661 tcggtagaca ccccgctggg tggtgattcc gaaaaagcgt tgctggacat cctggccgat 721 gaaaaagaga acggtccgga agataccacg caagatgacg atatgaagca gagcatcgtc 781 aaatggctgt tcgagctgaa cgccaaatag cgtgaagtgc tggcacgtcg attcggtttg 841 ctggggtacg aagcggcaac actggaagat gtaggtcgtg aaattggcct cacccgtgaa 901 cgtgttcgcc agattcaggt tgaaggcctg cgccgtttgc gcgaaatcct gcaaacgcag 961 gggctgaata tcgaagcgct gttccgcgag taa // ------------------------------------------------------------------------------ 7.2. Part of the contents in the accession number index file 'ddbjacc1.idx' The following excerpt from the accession number index file illustrates the format of the index. ------------------------------------------------------------------------------ D00001 ECPBPA BCT X04516 D00002 ECPYRC BCT X04469 D00003 HUMP450M HUM D00003 D00004 FLBFLBL40 VRL D00004 D00005 IBAMEM682 VRL D00005 D00006 BACPNS1981 BCT D00006 D00007 CHKCALGRP VRT D00007 D00008 ECPNTAB BCT X04195 D00009 DROPER1 INV D00009 ------------------------------------------------------------------------------ 7.3. Part of the contents in the keyword phrase index file 'ddbjkey1.idx' Keyword phrases consist of names for gene products and other characteristics of sequence entries. ------------------------------------------------------------------------------ "COAT PROTEIN SMO511347 VRL AJ511347 'TNPA GENE UBA564903 BCT AJ564903 'ZINC-FINGER' MOTIF PRNS53 VRL X60546 (+) MATING TYPE SURFACE PROTEIN ABGPSSP PLN M94861 (1,3 TABETGLUB PLN Z22874 (1,3)-BETA-D-GLUCAN BINDING PROTEIN AJ606470 INV AJ606470 (1,3)BETA-GLUCAN SYNTHASE NCU09275 PLN U09275 (1,4)-BETA-D-ARABINOXYLAN ARABINOFURANOHYDROLASE ANAXHA PLN Z78011 ANTUAXHA PLN Z78010 (1,6)-BETA-GLUCAN BIOSYNTHESIS YSAKRE1A PLN M81588 (1-3)-BETA-GLUCANASE NTSP41AGN PLN X81560 PA13BGPT PLN X57794 (1-3,1-4)-BETA-D-GLUCANASE HVBDG PLN X52572 (1-4)-BETA-MANNAN ENDOHYDROLASE CAR278996 PLN AJ278996 CAR293305 PLN AJ293305 (2',5'-OLIGOISOADENYLATE SYNTHETASE-DEPENDENT) AL138776 HUM AL138776 (2'-5') OLIGO(A) SYNTHASE E16 SSO4G06 EST F14610 (2'-5')OLIGOADENYLATE SYNTHETASE HSA225089 HUM AJ225089 HUMSYN25A HUM D00068 SSA225090 MAM AJ225090 (6')-IB' AMINOGLYCOSIDE ACETYLTRANSFERASE AXY278514 BCT AJ278514 PAE291609 BCT AJ291609 (8,11)-LINOLEOYL DESATURASE COF245938 PLN AJ245938 ------------------------------------------------------------------------------ 7.4. Part of the contents in the journal citation index file 'ddbjjou1.idx' The journal citation index file lists all of the citations that appear in the references. ------------------------------------------------------------------------------ (ER) AAPS PHARMSCI. 4 (3), DOI 10.1208/PS040315 (2002) AY170916 ROD AY170916 (ER) AM. J. HUM. GENET. 76 (1) (2004) IN PRESS AY753209S1 HUM AY753209 AY753209S2 HUM AY753210 (ER) ARCH. VIROL. (2004) IN PRESS AF531505 VRL AF531505 AY518899 VRL AY518899 AY518900 VRL AY518900 AY518901 VRL AY518901 AY518902 VRL AY518902 AY518903 VRL AY518903 AY518904 VRL AY518904 AY518905 VRL AY518905 AY518906 VRL AY518906 AY518907 VRL AY518907 AY518908 VRL AY518908 AY518909 VRL AY518909 AY518910 VRL AY518910 AY518911 VRL AY518911 AY518912 VRL AY518912 AY518913 VRL AY518913 AY518914 VRL AY518914 AY518915 VRL AY518915 AY518916 VRL AY518916 AY518917 VRL AY518917 AY518918 VRL AY518918 AY518919 VRL AY518919 AY518920 VRL AY518920 AY518921 VRL AY518921 AY518922 VRL AY518922 AY518923 VRL AY518923 AY518924 VRL AY518924 AY518925 VRL AY518925 AY518926 VRL AY518926 AY518927 VRL AY518927 AY518928 VRL AY518928 AY518929 VRL AY518929 AY518930 VRL AY518930 AY518931 VRL AY518931 AY518932 VRL AY518932 AY521234 VRL AY521234 AY521235 VRL AY521235 AY521236 VRL AY521236 AY521237 VRL AY521237 AY521238 VRL AY521238 (ER) ARTERIOSCLER. THROMB. VASC. BIOL. (2004) IN PRESS AY563557 HUM AY563557 (ER) BIOCHEM. BIOPHYS. RES. COMMUN. 325 (1), 203-214 (2004) AY563137 HUM AY563137 (ER) BIOCHEM. J./10.1042/BJ20030293 HSA496460 HUM AJ496460 ------------------------------------------------------------------------------ 7.5. Part of the contents in the gene name index file 'ddbjgen.idx' This file lists all the gene names that appear in the feature table. ------------------------------------------------------------------------------ 'ARR BX927156 BCT BX927156 'BGLG BX927156 BCT BX927156 'BGLS BX927148 BCT BX927148 'BGLY' BX927156 BCT BX927156 'BRNQ AF305888 BCT AF305888 'COMK AL591983 BCT AL591983 AL596172 BCT AL596172 'CRCB BX927155 BCT BX927155 'CRTI BX927155 BCT BX927155 'DPPE LDDIPEP BCT Z34898 'FIC BX936398 BCT BX936398 ------------------------------------------------------------------------------ 8. Release history Release Date Entries Bases Comments 76 12/08 98,220,409 98,741,908,446 75 09/08 92,840,037 95,219,505,205 TSA division started 74 06/08 87,903,140 91,294,770,939 73 03/08 83,167,582 86,099,950,395 KIPO inclusion started 72 12/07 79,004,098 82,592,245,487 Most of E-mail addresses discarded 71 09/07 76,273,345 79,706,204,461 70 06/07 72,801,679 76,788,510,646 69 03/07 67,523,680 71,775,679,500 PROJECT line started Indexes for categories terminated 68 12/06 64,267,978 68,259,314,742 1.5 GB storage started 67 09/06 61,144,621 65,443,024,193 66 06/06 58,176,628 62,945,843,881 65 03/06 55,890,995 60,564,721,635 TPA subcategories started 64 12/05 52,272,669 56,098,558,378 Some index files split 63 09/05 47,741,593 52,246,110,341 62 06/05 45,249,444 49,158,155,283 ENV division started Version for release note started 61 03/05 43,118,204 47,099,081,750 Changed style of release note 60 12/04 40,583,945 44,416,752,273 /db_xref="H-inv:**" started 59 09/04 37,926,117 42,245,956,937 58 06/04 34,917,581 39,812,635,108 57 03/04 32,693,678 38,008,449,840 56 12/03 30,405,173 36,079,046,032 55 09/03 27,753,140 34,280,225,489 54 06/03 25,149,821 32,162,041,177 53 02/03 23,250,813 29,711,299,332 52 12/02 20,354,812 26,931,456,316 51 09/02 18,401,358 22,782,404,136 TPA started 50 06/02 17,260,693 20,158,357,982 49 04/02 16,503,157 18,579,627,226 48 01/02 15,016,100 16,197,713,855 47 10/01 13,266,610 14,145,671,645 46 07/01 12,313,759 13,037,646,166 45 04/01 11,434,113 12,207,092,905 HTC division started 44 01/01 10,165,597 11,136,298,841 43 10/00 8,666,551 10,034,532,698 42 07/00 7,554,995 8,880,721,093 41 04/00 5,962,608 6,409,581,885 CON division started 40 01/00 5,388,125 4,762,696,173 RNA division terminated 39 10/99 4,810,773 3,728,000,562 NID and PID discarded 38 07/99 4,294,369 3,098,519,597 37 03/99 3,311,627 2,375,261,951 VERSION, /protein_id started 36 01/99 3,073,166 2,190,425,560 35 10/98 2,759,261 1,957,341,169 34 07/98 2,412,785 1,708,580,623 33 04/98 2,174,769 1,479,303,279 32 01/98 1,956,669 1,300,950,613 31 10/97 1,731,532 1,139,869,464 Adoption of the unified taxonomy database 30 07/97 1,534,115 992,788,339 NID and PID terminated 29 04/97 1,270,194 841,415,232 28 01/97 1,154,120 756,785,219 HTG division started ORG division terminated 27 10/96 936,697 608,103,057 GSS division started 26 07/96 835,552 551,932,448 25 04/96 744,490 499,300,364 /translation started 24 01/96 637,508 431,771,652 23 10/95 569,757 390,694,350 22 07/95 437,588 322,982,425 HUM division started 21 04/95 274,596 250,875,023 20 01/95 239,689 231,299,557 19 10/94 204,332 205,274,131 18 07/94 185,230 192,473,021 17 04/94 169,957 179,942,209 16 01/94 154,626 165,017,628 15 10/93 131,649 147,224,690 14 07/93 120,350 138,686,333 JPO inclusion started 13 04/93 112,067 129,784,445 12 01/93 97,683 120,815,244 EST division started 11 07/92 65,693 84,839,075 10 01/92 59,317 77,805,556 GenBank/EMBL inclusion started 9 07/91 1,130 2,002,124 8 01/91 879 1,573,442 7 07/90 681 1,154,211 6 01/90 496 841,236 5 07/89 395 679,378 4 01/89 302 535,985 3 07/88 230 345,850 2 01/88 142 199,392 1 07/87 66 108,970 Started with DDBJ only ------------------ Since release 75 ------------------ A new division for assembled mRNA sequences, Transcriptome Shotgun Assembly (TSA), has been included since the release 75. With new sequencing technologies in use, INSDC have faced many requests to accept assembled EST sequences. These sequence data have become more useful than used to be, although they may not be correctly assembled or exist in nature. Therefore, INSDC decided to collect assembled EST sequences and classified them into the new division 'TSA'. TSA sequences are shotgun assemblies of primary sequences deposited in the EST division of INSDC, race Archive (TA) or Short-Read Archive (SRA). Two specific keywords, "TSA" and "Transcriptome Shotgun Assembly", are present in all TSA entries. The new division code, "TSA", is also described in the the LOCUS line in all TSA entries. No format changes in the flat file are anticipated for the TSA division, however, note that TSA entries make use of the same PRIMARY line that is described for the entries in TPA category (See also '3.2. TPA separated from primary dataset'). The PRIMARY block contains references to the underlying reads/transcripts that are assembled to construct a TSA record. Note that it is required for a TSA submission to submit sequence data of primary transcripts to the EST division of INSDC, TA, or SRA. More information about how to submit a TSA entry is provided via the following URL; http://www.ddbj.nig.ac.jp/sub/tsa-e.html ------------------ Since release 73 ------------------ Introduction of the sequence data from the Korean Intellectual Property Office: The nucleotide sequence data transferred from Korean Intellectual Property Office (KIPO) have been included in DDBJ release. See also, '3.1. Division categories' and '3.3. Notice for patent related sequence data'. ------------------ Since release 72 ------------------ Deletion of E-mail address, phone and fax numbers from DDBJ flat file: To follow the Japanese law of protecting personal information, DDBJ deleted both phone and fax numbers, and E-mail address from the flat files of the entries submitted to DDBJ. It would be also helpful to protect DDBJ releases against SPAM mail senders. DDBJ retrofitted most of all entries submitted to DDBJ, not to GenBank or EMBL, by the DDBJ periodical release 72. Previously, the submitter information was described in JOURNAL line at REFERENCE 1 as, -------------------------------------------------------------------------------- REFERENCE 1 (bases 1 to 1200) AUTHORS Mishima,T. TITLE Direct Submission JOURNAL Submitted (01-Jan-1990) to the DDBJ/EMBL/GenBank databases. Taro Mishima, DNA Data Bank of Japan, National Institute of Genetics; 1111, Yata, Mishima, Shizuoka 411-8540, Japan (E-mail:ddbj@ddbj.nig.ac.jp, URL:http://www.ddbj.nig.ac.jp/, Tel:81-12-345-6789, Fax:81-12-345-9876) -------------------------------------------------------------------------------- After the deletion or the information in question, DDBJ flat file is either one of the following two types; Type 1: Phone and fax numbers and E-mail address are deleted. -------------------------------------------------------------------------------- REFERENCE 1 (bases 1 to 1200) AUTHORS Mishima,T. TITLE Direct Submission JOURNAL Submitted (01-Jan-1990) to the DDBJ/EMBL/GenBank databases. Contact:Taro Mishima DNA Data Bank of Japan, National Institute of Genetics; 1111, Yata, Mishima, Shizuoka 411-8540, Japan URL :http://www.ddbj.nig.ac.jp/ ------------------------------------------------------------------------------- Type 2: When the submitters wish to keep their contact information disclosed, it is described as, ------------------------------------------------------------------------------- REFERENCE 1 (bases 1 to 1200) AUTHORS Mishima,T. TITLE Direct Submission JOURNAL Submitted (01-Jan-1990) to the DDBJ/EMBL/GenBank databases. Contact:Taro Mishima DNA Data Bank of Japan, National Institute of Genetics; 1111, Yata, Mishima, Shizuoka 411-8540, Japan URL :http://www.ddbj.nig.ac.jp/ E-mail :ddbj@ddbj.nig.ac.jp Phone :81-12-345-6789 Fax :81-12-345-9876 ------------------------------------------------------------------------------- ------------------ Since release 69 ------------------ Introduction of the project ID at PROJECT line in DDBJ flat file: Following the agreement at the INSD collaborative meeting in 2006, INSDC has started to assign the project ID for submissions from sequencing projects. The description of project ID is shown as below; ---------------------------------------------------------------------------- A unique identifier, assigned at the time of the submission by a sequencing project that informed INSDC of the submission beforehand. It is recommended that the submitter quotes the assigned project ID in all communication with INSDC databases to allow for easier and faster tracking of issues. The project ID field provides an umbrella identifier that points to all related sequence data for the project. ---------------------------------------------------------------------------- The PROJECT lines contain INSDC-assigned ID for the sequencing project. It will be appeared between VERSION and KEYWORDS lines in DDBJ flat files, from the DDBJ periodical release, 69 as shown below. See also '2. DDBJ flat file format'. ---------------------------------------------------------------------------- ACCESSION AB012345 VERSION AB012345.1 PROJECT GenomeProject:123 KEYWORDS . ---------------------------------------------------------------------------- Termination of providing the index files for each category: For users logging in one of our computers (supernig), we provided index files for each category. However, as the computer system in our institute was replaced with a new one which does not have a service using the index files, we terminated providing the index files. ------------------ Since release 68 ------------------ Split of files: We changed the maximum file size from 300 MB to 1.5 GB, because the network capacity has been remarkably increased. Each file named as ddbj***##.seq has at most 1.5 GB storage capacity. See also the sections, '6. File categories' and '9. File list'. ------------------ Since release 65 ------------------ Introduction of two types of TPA entries: According to the decision of ICM 2005, TPA data set is now classified into two categories, "TPA:experimental" and "TPA:inferential", to distinguish TPA annotation supported by wet-lab. experimental evidence and that inferred. The retrofit to divide TPA entries into two categories starts from the release 65. You can find the description of the two TPA categories at the following URLs; http://www.ddbj.nig.ac.jp/sub/tpa-e.html http://www.insdc.org/TPA.html See also '3.2. TPA separated from primary dataset'. ------------------ Since release 64 ------------------ Split of index files: In the present release, some of index files (ddbjacc.idx, ddbjjou.idx, and ddbjkey.idx) have been greater than 2 GB in the file size. So, these have been recorded in multiple ddbj****.idx files, each of which at most has 1.5 GB storage capacity as follows, respectively. See also 6., 7.2., 7.3., 7.4. and 9. ------------------ Since release 62 ------------------ Release version number is introduced: DDBJ has started to include the item, 'version', for its release note, which indicates a version for its periodical release. It is expressed like '62.0', in which the digit(s) after the period is a version number. The reason for adding the version number is that a released data is sometimes revised due to urgent and necessary corrections. The number is increased by one every time when a revised periodical release is made public until the next release. Introduction of ENV division: Recently, the submissions of the sequences derived from environmental samples have rapidly increased. To accommodate such submissions, a new division, ENV, has been created (See also '3.1. Division categories'). This division contains the sequences obtained via direct molecular isolation such as PCR, DGGE, or any anonymous method. In the past, the sequences derived from environmental samples belonged to taxonomic divisions, mainly BCT. At DDBJ, the retrofit to transfer relevant entries from taxonomic divisions to the ENV division starts in the present release, and ends by the next periodical release. Please note that during this transitional period, some entries to be eventually placed in the ENV division will be found in other divisions. Strand information is removed: The strand information of LOCUS line in the flat file has been removed as shown below. See also '2.1. LOCUS line'. ---------------------------------------------------------------------------- Old (-rel. 61): 44-44 space 45-47 spaces, ss- (single-stranded), ds- (double-stranded), or ms- (mixed-stranded) New (rel. 62-): 44-47 spaces ---------------------------------------------------------------------------- ------------------ Since release 61 ------------------ The style of release note (this file) has been changed. Some entries have the sequential format for the secondary accession numbers in the ACCESSION line, in order to make the expression of secondary accession numbers in the past short. For example; ------------------------------------------------------------------------------ Before; ACCESSION AB000802 D85885 D85886 D85887 After; ACCESSION AB000802 D85885-D85887 ------------------------------------------------------------------------------ See also '2.3. ACCESSION line'. ------------------ Since release 60 ------------------ The cross-reference to the H-invitational has been included. ------------------ Since release 56 ------------------ The three data banks have agreed that the maximum length limitation (350 kb) of a submitted sequence be relaxed. The BASE COUNT line of the DDBJ flat file format has been changed, corresponding to the relaxation of the maximum sequence length restriction in the entry that had been practiced at DDBJ/EMBL/GenBank International Nucleotide Sequence Databases. In the BASE COUNT line of the DDBJ flat file, 6 digits had been allocated for each number of a, c, g, t and other bases in the sequence. Hereafter, in the new flat file format, 9 digits are allocated for each number of a, c, g and t, while the numbers of other bases are removed. In accordance with the relaxation of sequence length limitation, GenBank had already dropped the BASE COUNT line from their flat file format from GenBank Release 138 (Oct. 2003). We DDBJ have decided to maintain the BASE COUNT line in our flat file format from the view that GC contents are still important information to characterize the sequence. The changes in the BASE COUNT line are shown below. ---------------------------------------------------------------------------- Old (-rel. 55): 1 6 11 16 21 26 31 36 41 46 51 56 61 66 71 |----|----|----|----|----|----|----|----|----|----|----|----|----|----| BASE COUNT 123456 a 123456 c 123456 g 123456 t 123456 others New (rel. 56-): 1 6 11 16 21 26 31 36 41 46 51 56 61 66 71 |----|----|----|----|----|----|----|----|----|----|----|----|----|----| BASE COUNT 123456789 a 123456789 c 123456789 g 123456789 t ---------------------------------------------------------------------------- The SOURCE in the flat file is revisited and revised if necessary in accordance with the unified taxonomy database common to the three data banks. ------------------ Since release 54 ------------------ '/sequenced_mol' qualifier has been changed to '/mol_type' qualifier. We accordingly completed retrofitting the pertinent entries. This change was made on the agreement at the INSD collaborative meeting in 2002. ------------------ Since release 51 ------------------ The TPA (Third Party Annotation) dataset has been available. The dataset is a complement to the existing DDBJ/EMBL/GenBank database of the primary nucleotide sequences which were obtained from direct sequencing of cDNAs, ESTs, genomic DNAs etc. The format of LOCUS line in the flat file has been changed as shown below to adjust to the GenBank format. ------------------------------------------------------------------------------ Old (-rel. 50): LOCUS AB000001 660 bp DNA PLN 01-FEB-2001 New (rel. 51-): LOCUS AB000001 660 bp DNA linear PLN 01-FEB-2001 ------------------------------------------------------------------------------ ------------------ Since release 45 ------------------ The HTC (High Throughput cDNA) division has been included. This is to include unfinished high throughput cDNA sequences, each of which has 5'UTR and 3'UTR at both ends and part of a coding region. The sequence may also include introns. When the sequence becomes finished later, it moves to the corresponding taxonomic division. The sequence is accompanied with a keyword, HTC (High Throughput cDNA), which is dropped when the sequence is finished and moved to a taxonomic division. ------------------ Since release 41 ------------------ The CON division has been included. This division is to show the order of related sequences in a genome, and expressed by join and the accession numbers of the sequences. The contents of the CON division are compiled by the three data banks not by the data submitter. ------------------ Since release 40 ------------------ The RNA division was terminated. The RNA data have been redistributed according to the category of the organism. Therefore, you will find a human RNA sequence, for example, in the HUM division. ------------------ Since release 37 ------------------ The three data banks include the item VERSION in the flat file, which indicates a version of a submitted nucleotide sequence. It is expressed like AB123456.1, in which the digit(s) after the period is a version number. The reason for adding VERSION is that since a released sequence sometimes revised by the submitter, the accession number alone cannot specify the sequence in question causing the user a trouble. The number is increased by one every time when a revised sequence is made public. Accordingly, the translated protein sequence will be accompanied with a /protein_id which is expressed as BAA12345.1, in which the digit(s) after the period is again a version number. The number is increased by one when the corresponding nucleotide sequence is revised and the protein sequence is changed as a result, and when the revised protein sequence is made public. ------------------ Since release 31 ------------------ We have started adopting the unified taxonomy database to unify the biological source of the sequence. The database is made up with scientific names, ID of unidentified organisms, and synthetic constructs etc. ------------------ Since release 30 ------------------ NID and PID were terminated. This change was made on the agreement at the INSD collaborative meeting in 1999. ------------------ Since release 28 ------------------ The HTG (High Throughput Genomic sequence) has been included. This division was created to cope with genome project teams which deal with a clone as a sequencing unit. We terminated the ORG (Organelle) division. Thus, if you are interested in human mitochondrial sequences, for example, you are now advised to refer to the HUM division. ------------------ Since release 27 ------------------ The GSS division has been included. GSS stands for Genome Survey Sequence, which is similar to EST, except that GSS is genomic DNA whereas EST is cDNA. ------------------ Since release 25 ------------------ DDBJ release contains amino acid sequences that were translated from the corresponding nucleotide sequences of the database. In the translation we paid much attention to the fact that some species or organella have a codon different from the universal one, and used the proper codon table. ------------------ Since release 22 ------------------ The HUM division has been included. Human genome projects have probably been most productive and yielded a large number of sequences Thus, we have the human (HUM) division solely for human sequences and the primate (PRI) division for non-human primate sequences. ------------------ Since release 12 ------------------ The EST (Expressed Sequence Tag) division has been included. The number of ESTs has been increasing at an enormous rate and is expected to be growing even more rapidly in the future. Thus, we created a division for ESTs ------------------ Since release 10 ------------------ The sequences submitted to GenBank or EMBL have been included in the release. 9. File list The files in this release are arranged in the following order with non-labeled format. ----------------------------------------------------------------------- file name file size ----------------------------------------------------------------------- ddbjrel.txt (DDBJ release note) 70734 ddbjacc1.idx (Accession number index file 1) 1499999977 ddbjacc2.idx (Accession number index file 2) 1500000006 ddbjacc3.idx (Accession number index file 3) 831715889 ddbjgen.idx (Gene name index file) 137422867 ddbjjou1.idx (Journal citation index file 1) 1497583185 ddbjjou2.idx (Journal citation index file 2) 1339977976 ddbjjou3.idx (Journal citation index file 3) 1249664282 ddbjkey1.idx (Keyword phrase index file 1) 457916222 ddbjkey2.idx (Keyword phrase index file 2) 1710735743 ddbjkey3.idx (Keyword phrase index file 3) 1499619553 ddbjkey4.idx (Keyword phrase index file 4) 311944236 ----------------------------------------------------------------------- file name number of entries number of bases file size ----------------------------------------------------------------------- ddbjbct1.seq 124615 611930055 1501563171 ddbjbct2.seq 90193 634133028 1502682977 ddbjbct3.seq 323 677817325 1499849115 ddbjbct4.seq 350 660720891 1502558514 ddbjbct5.seq 115774 608612645 1499002895 ddbjbct6.seq 91328 156253987 433407616 ddbjenv1.seq 587961 393553666 1499004718 ddbjenv2.seq 351004 322910080 1020289493 ddbjest1.seq 462669 173118679 1499002183 ddbjest2.seq 490456 191879518 1499000109 ddbjest3.seq 497912 205913815 1499001245 ddbjest4.seq 479804 204800222 1499000232 ddbjest5.seq 549740 296431862 1499000149 ddbjest6.seq 562613 339715238 1499002894 ddbjest7.seq 540521 307099781 1499001099 ddbjest8.seq 388166 120450303 1499002299 ddbjest9.seq 496071 213905412 1499002887 ddbjest10.seq 514206 237511082 1499000919 ddbjest11.seq 473003 200345113 1499003078 ddbjest12.seq 358335 127248870 1499001069 ddbjest13.seq 274412 83724325 1499002722 ddbjest14.seq 274780 108919165 1499002115 ddbjest15.seq 390817 182601046 1499002171 ddbjest16.seq 481575 251015803 1499002398 ddbjest17.seq 461680 243073991 1499000241 ddbjest18.seq 449435 244666752 1499001268 ddbjest19.seq 466222 229842675 1499003625 ddbjest20.seq 461120 277989263 1499002568 ddbjest21.seq 474060 286882121 1499001738 ddbjest22.seq 465419 242870403 1499002001 ddbjest23.seq 446731 263200153 1499002791 ddbjest24.seq 516694 284109091 1499000926 ddbjest25.seq 539064 314920088 1499001039 ddbjest26.seq 413662 207862586 1499002177 ddbjest27.seq 432420 261961001 1499003276 ddbjest28.seq 480136 267287820 1499000434 ddbjest29.seq 516724 257538506 1499002263 ddbjest30.seq 450471 241560621 1499001291 ddbjest31.seq 453400 256802579 1499002769 ddbjest32.seq 443118 293098790 1499000636 ddbjest33.seq 409741 288860253 1499000617 ddbjest34.seq 516990 309907889 1499001166 ddbjest35.seq 623185 356796135 1499001180 ddbjest36.seq 463888 298240710 1499001064 ddbjest37.seq 409107 234533786 1499005369 ddbjest38.seq 258743 96631939 1499005311 ddbjest39.seq 258206 105777404 1499000461 ddbjest40.seq 330884 162094942 1499001741 ddbjest41.seq 471078 267622620 1499001109 ddbjest42.seq 484789 269760313 1499001633 ddbjest43.seq 448706 240997628 1499001875 ddbjest44.seq 496399 284719562 1499001632 ddbjest45.seq 495169 258552987 1499001341 ddbjest46.seq 443889 254801388 1499001901 ddbjest47.seq 545629 285419701 1499000392 ddbjest48.seq 434955 252804730 1499002560 ddbjest49.seq 380645 214543262 1499003933 ddbjest50.seq 262017 132093326 1499004416 ddbjest51.seq 266900 108126054 1499000685 ddbjest52.seq 314297 140145525 1499003828 ddbjest53.seq 427583 243514483 1499001366 ddbjest54.seq 548703 309525977 1499001096 ddbjest55.seq 429472 286347477 1499000191 ddbjest56.seq 440705 243550755 1499000019 ddbjest57.seq 475922 279468761 1499003101 ddbjest58.seq 444136 240594723 1499000054 ddbjest59.seq 462124 266710470 1499002155 ddbjest60.seq 459690 274419498 1499001064 ddbjest61.seq 418431 246712302 1499002013 ddbjest62.seq 540419 349864386 1499001590 ddbjest63.seq 435259 277240534 1499002937 ddbjest64.seq 467123 245455073 1499001543 ddbjest65.seq 456111 275820665 1499001834 ddbjest66.seq 402755 260791891 1499001652 ddbjest67.seq 396201 252117830 1499001115 ddbjest68.seq 426233 235839820 1499000584 ddbjest69.seq 419693 235332441 1499002301 ddbjest70.seq 427349 234873123 1499002564 ddbjest71.seq 463712 250417135 1499000600 ddbjest72.seq 512753 302365032 1499002389 ddbjest73.seq 499906 313933871 1499001630 ddbjest74.seq 532106 320295350 1499004354 ddbjest75.seq 510770 303617666 1499005015 ddbjest76.seq 385338 286605737 1499003339 ddbjest77.seq 490967 296801172 1499000921 ddbjest78.seq 378464 271454794 1499000255 ddbjest79.seq 392364 263547952 1499000868 ddbjest80.seq 371672 259716691 1499004435 ddbjest81.seq 415696 327677326 1499002802 ddbjest82.seq 463650 295823566 1499001671 ddbjest83.seq 464888 319465614 1499001476 ddbjest84.seq 534150 295901797 1499001542 ddbjest85.seq 523651 209672904 1499000071 ddbjest86.seq 522640 301889501 1499001783 ddbjest87.seq 476822 325869286 1499000880 ddbjest88.seq 524034 303173258 1499002543 ddbjest89.seq 672478 324745581 1499002031 ddbjest90.seq 596562 258454271 1499002052 ddbjest91.seq 454746 293039879 1499000534 ddbjest92.seq 528751 321673148 1498999924 ddbjest93.seq 545354 177699248 1499001871 ddbjest94.seq 518980 325933497 1499001494 ddbjest95.seq 492205 270329192 1499000111 ddbjest96.seq 431026 236335099 1499000716 ddbjest97.seq 630886 170929561 1499002017 ddbjest98.seq 488476 276467200 1499001299 ddbjest99.seq 581216 258435063 1499000218 ddbjest100.seq 495925 299622179 1499003397 ddbjest101.seq 495508 303758503 1499001228 ddbjest102.seq 548785 254154096 1499000152 ddbjest103.seq 570900 235300147 1499000193 ddbjest104.seq 476306 301522419 1499001207 ddbjest105.seq 425699 287752815 1499000792 ddbjest106.seq 467991 281457336 1499000643 ddbjest107.seq 446439 302849746 1499001294 ddbjest108.seq 469319 338663925 1499001377 ddbjest109.seq 404468 275356591 1499000036 ddbjest110.seq 434856 284816164 1499000550 ddbjest111.seq 452464 281487394 1499001534 ddbjest112.seq 419956 262746301 1499001788 ddbjest113.seq 448633 252136277 1499002889 ddbjest114.seq 377109 241146620 1499000149 ddbjest115.seq 541591 254963753 1499002230 ddbjest116.seq 448669 278577771 1499000967 ddbjest117.seq 460237 292234431 1499000702 ddbjest118.seq 439180 279977984 1499007185 ddbjest119.seq 305336 180834863 1499001513 ddbjest120.seq 442631 118866107 1499000295 ddbjest121.seq 639149 314889420 1499000759 ddbjest122.seq 452801 271966016 1499001188 ddbjest123.seq 484507 281137438 1499002127 ddbjest124.seq 462279 50362434 1499002637 ddbjest125.seq 450039 126441408 1499001670 ddbjest126.seq 482464 314162909 1499001756 ddbjest127.seq 419717 269132701 1499002852 ddbjest128.seq 430222 158254126 1362604588 ddbjgss1.seq 482977 349316999 1499003163 ddbjgss2.seq 446074 340590756 1499002244 ddbjgss3.seq 445705 336004100 1499002323 ddbjgss4.seq 564492 274072525 1499000669 ddbjgss5.seq 488027 252334780 1499001825 ddbjgss6.seq 465691 255632772 1499001282 ddbjgss7.seq 389388 193257511 1499000072 ddbjgss8.seq 418432 210958502 1499002941 ddbjgss9.seq 500076 291288519 1499001550 ddbjgss10.seq 557563 311343638 1499001668 ddbjgss11.seq 497605 293068785 1499002695 ddbjgss12.seq 535608 351064598 1499002218 ddbjgss13.seq 522358 366383553 1499000778 ddbjgss14.seq 515480 355290368 1499000360 ddbjgss15.seq 607454 340284483 1499002504 ddbjgss16.seq 605685 371996554 1499001377 ddbjgss17.seq 566319 315037990 1499001183 ddbjgss18.seq 522976 376516852 1499001008 ddbjgss19.seq 512048 342234620 1499001972 ddbjgss20.seq 605192 388427942 1499003085 ddbjgss21.seq 586320 417795035 1499001456 ddbjgss22.seq 539029 312744903 1499000214 ddbjgss23.seq 481707 290898578 1499001631 ddbjgss24.seq 521345 348617557 1499000330 ddbjgss25.seq 531187 339091790 1499002521 ddbjgss26.seq 538381 342117902 1499001369 ddbjgss27.seq 607482 299841786 1499002156 ddbjgss28.seq 549409 260839769 1499000372 ddbjgss29.seq 535175 376087786 1499001071 ddbjgss30.seq 477014 328813997 1499002154 ddbjgss31.seq 485893 379224407 1499002394 ddbjgss32.seq 555011 356479041 1499000305 ddbjgss33.seq 537396 345440858 1499001934 ddbjgss34.seq 483392 344166727 1499000337 ddbjgss35.seq 538523 302320520 1499001136 ddbjgss36.seq 526681 314754726 1499000367 ddbjgss37.seq 513189 261348891 1499001735 ddbjgss38.seq 414279 336327199 1499001551 ddbjgss39.seq 419126 346701478 1499001169 ddbjgss40.seq 426565 341103552 1499002453 ddbjgss41.seq 419745 346205913 1499000009 ddbjgss42.seq 426327 346137061 1499000679 ddbjgss43.seq 420742 339891014 1499001358 ddbjgss44.seq 463647 342970896 1499000645 ddbjgss45.seq 512305 336556441 1499001805 ddbjgss46.seq 616672 392710170 1499001352 ddbjgss47.seq 599113 417981667 1499001997 ddbjgss48.seq 545976 391406825 1499000984 ddbjgss49.seq 139169 84113921 502313090 ddbjhtc1.seq 281010 357181145 1499002383 ddbjhtc2.seq 250458 250725916 889871937 ddbjhtg1.seq 11402 1118404302 1499230017 ddbjhtg2.seq 7562 1118425200 1499205205 ddbjhtg3.seq 5893 1130863113 1499061607 ddbjhtg4.seq 5460 1140257124 1499242227 ddbjhtg5.seq 5297 1144349357 1499127828 ddbjhtg6.seq 5341 1144249244 1499028286 ddbjhtg7.seq 6531 1132461073 1499037462 ddbjhtg8.seq 6883 1142744365 1499167859 ddbjhtg9.seq 6291 1139758398 1499214446 ddbjhtg10.seq 6292 1133161577 1499033193 ddbjhtg11.seq 7002 1124870770 1499014447 ddbjhtg12.seq 7030 1123678238 1499052924 ddbjhtg13.seq 6935 1142132106 1499088749 ddbjhtg14.seq 7035 1135711332 1499134478 ddbjhtg15.seq 6859 1142024952 1499055921 ddbjhtg16.seq 6433 1140511675 1499275412 ddbjhtg17.seq 6499 1138487365 1499190873 ddbjhtg18.seq 7145 1129635648 1499158936 ddbjhtg19.seq 6558 1154439609 1499113668 ddbjhtg20.seq 6951 1154760710 1499009729 ddbjhtg21.seq 2815 411127743 535800877 ddbjhum1.seq 28031 1050703988 1499032448 ddbjhum2.seq 8122 1069652950 1499119271 ddbjhum3.seq 142732 831672401 1499096694 ddbjhum4.seq 30829 1057216722 1499001607 ddbjhum5.seq 257403 507333741 1397231707 ddbjinv1.seq 230207 708205346 1502643078 ddbjinv2.seq 452374 430093483 1499000704 ddbjinv3.seq 32273 101777679 231466480 ddbjmam.seq 173754 456968327 968944111 ddbjpat1.seq 1035455 520129695 1499000125 ddbjpat2.seq 777120 494247745 1499001873 ddbjpat3.seq 745514 346976102 1499000382 ddbjpat4.seq 697155 602769909 1499000480 ddbjpat5.seq 739443 390541150 1499001268 ddbjpat6.seq 737685 334223150 1499011882 ddbjpat7.seq 783093 561033730 1499000273 ddbjpat8.seq 916249 519939033 1499000006 ddbjpat9.seq 571883 87724178 545791192 ddbjphg.seq 4079 32444882 79457359 ddbjpln1.seq 159914 856384841 1499003113 ddbjpln2.seq 203840 625808828 1499010088 ddbjpln3.seq 49714 933609786 1509265619 ddbjpln4.seq 263801 641345399 1499002452 ddbjpln5.seq 444273 469219940 1499000725 ddbjpln6.seq 208243 176402233 617895962 ddbjpri1.seq 49002 1080332482 1499200573 ddbjpri2.seq 18622 42761822 94518165 ddbjrod1.seq 34055 1020561674 1499080216 ddbjrod2.seq 5895 1093059065 1499193983 ddbjrod3.seq 41102 1053350626 1499165822 ddbjrod4.seq 76026 909363502 1499054714 ddbjrod5.seq 200242 76775021 438695157 ddbjsts1.seq 419221 211872568 1499004295 ddbjsts2.seq 342111 240047948 1499000764 ddbjsts3.seq 538312 171832872 1373123908 ddbjsyn.seq 76638 111877253 399261541 ddbjtsa.seq 3226 2730222 10221635 ddbjuna.seq 277 477527 1360437 ddbjvrl1.seq 396047 405491808 1499001071 ddbjvrl2.seq 226705 249167294 886939977 ddbjvrt1.seq 245016 659069443 1499000987 ddbjvrt2.seq 45664 1071455633 1499149605 ddbjvrt3.seq 221877 465768250 1060111133 ----------------------------------------------------------------------- Total 98220409 98741908446 359146745880 ddbjtpa.seq 6016 24899943 51947693 ddbjcon1.seq 379847 0 1499430074 ddbjcon2.seq 297979 0 1499000884 ddbjcon3.seq 367558 0 1499003136 ddbjcon4.seq 226855 0 1498999950 ddbjcon5.seq 267832 0 1499003539 ddbjcon6.seq 226550 0 1499004239 ddbjcon7.seq 255397 0 1499001563 ddbjcon8.seq 309714 0 1499002737 ddbjcon9.seq 303105 0 1499003506 ddbjcon10.seq 288532 0 1499005334 ddbjcon11.seq 258284 0 1499002921 ddbjcon12.seq 283907 0 1499004409 ddbjcon13.seq 262980 0 1499004492 ddbjcon14.seq 245757 0 1499005306 ddbjcon15.seq 225344 0 1499006479 ddbjcon16.seq 524097 0 1499000734 ddbjcon17.seq 523492 0 1499002260 ddbjcon18.seq 490113 0 1447763107 The entries and bases in the CON division and TPA dataset are not counted in the numbers given on the top of the release note or 'Total' on the above table.