DNA Data Bank of Japan DNA Database Release 77.0, Mar. 2009, including 102,099,156 entries, 101,765,388,414 bases Last published date in the present release: February 27, 2009 ------------------------------------------------------------------------------- Table of contents ------------------------------------------------------------------------------- 1. Introduction 1.1. Announcement for changes in the present release 1.2. Announcement for the forthcoming changes 2. DDBJ flat file format 2.1. LOCUS line 2.2. DEFINITION line 2.3. ACCESSION line 2.4. VERSION line 2.5. KEYWORDS line 2.6. SOURCE line 2.7. REFERENCE line 2.8. COMMENT line 2.9. FEATURES line 2.10. BASE COUNT line 2.11. ORIGIN line 3. Dataset categories 3.1. Division categories 3.2. TPA separated from primary dataset 3.3. Notice for patent related sequence data 4. DDBJ staff 5. Acknowledgment 6. File categories 7. Sample of the contents in each file 7.1. Part of the contents in the file 'ddbjbct1.seq' 7.2. Part of the contents in the accession number index file 'ddbjacc1.idx' 7.3. Part of the contents in the keyword phrase index file 'ddbjkey1.idx' 7.4. Part of the contents in the journal citation index file 'ddbjjou1.idx' 7.5. Part of the contents in the gene name index 'ddbjgen.idx' 8. Release history 9. File list ------------------------------------------------------------------------------- 1. Introduction The present release contains the newest data prepared by the DNA Data Bank of Japan (DDBJ), GenBank (*), and EMBL-Bank/European Bioinformatics Institute (EMBL/EBI) as of February 27, 2009. This unified database was made possible thanks to the international collaboration among the three data banks. All the entries have accordingly been annotated using the feature keys common to them. In 2005, DDBJ, EMBL-Bank and GenBank agreed to call their collaboration "the International Nucleotide Sequence Database Collaboration (INSDC); http://www.insdc.org " and to call the unified nucleotide sequence database "the International Nucleotide Sequence Database (INSD)". *'GenBank' is a trademark of NIH, USA, and is operated by National Center for Biotechnology Information (NCBI) at NIH. This database may be copied and redistributed without permission on the condition that all the statements in this release note are reproduced in each copy. See also '3.3. Notice for patented data' below. 1.1. Announcement for changes in the present release Nothing particular. 1.2. Announcement for the forthcoming changes A new line, DBLINK, will replace PROJECT line in the next DDBJ release or later. Following the agreement at the INSD collaborative meeting in 2008, the scope of the project ID has expanded to include projects that are not necessarily targeted to the sequencing of a complete genome. In addition, there are other resources such as the Trace Assembly Archive at the NCBI and the like. Therefore, we have decided to replace the PROJECT line by a new line format, "DBLINK". The replacement is illustrated in the following; From the use of the PROJECT line at present; ------------------------------------------------------------------------------- LOCUS AP000000 4700000 bp DNA circular BCT 27-FEB-2009 DEFINITION Escherichia coli DDBJ genomic DNA, complete genome. ACCESSION AP000000 VERSION AP000000.1 PROJECT GenomeProject:99999 KEYWORDS . ------------------------------------------------------------------------------- To the DBLINK line format in future; ------------------------------------------------------------------------------- LOCUS AP000000 4700000 bp DNA circular BCT 27-FEB-2009 DEFINITION Escherichia coli DDBJ genomic DNA, complete genome. ACCESSION AP000000 VERSION AP000000.1 DBLINK Project:99999 KEYWORDS . ------------------------------------------------------------------------------- 2. DDBJ flat file format The database is a collection of "entry" which is the unit of the data. The entries submitted to databanks were processed and publicized according to the DDBJ format for distribution (flat file). The flat file includes the sequence and the information of submitters, references, source organisms, and "feature" information, etc. The items of the DDBJ flat file are explained at following; ------------------------------------------------------------------------------- LOCUS AB000000 450 bp mRNA linear HUM 08-JUL-2002 DEFINITION Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds. ACCESSION AB000000 VERSION AB000000.1 KEYWORDS . SOURCE Homo sapiens ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 450) AUTHORS Mishima,H. and Shizuoka,T. TITLE Direct Submission JOURNAL Submitted (30-NOV-2000) to the DDBJ/EMBL/GenBank databases. Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; 1111, Yata, Mishima, Shizuoka 411-8540, Japan REFERENCE 2 (sites) AUTHORS Mishima,H., Shizuoka,T. and Fuji,I. TITLE Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver JOURNAL Unpublished (2002) COMMENT Human cDNA sequencing project. FEATURES Location/Qualifiers source 1..450 /chromosome="12" /clone="GT200015" /clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)" /map="12p13" /mol_type="mRNA" /organism="Homo sapiens" /tissue_type="liver" CDS 86..>450 /codon_start=1 /gene="GAPD" /product="glyceraldehyde-3-phosphate dehydrogenase" /protein_id="BAA12345.1" /transl_table=1 /translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV" BASE COUNT 102 a 119 c 131 g 98 t ORIGIN 1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct 61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg 121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc 181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt 241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg 301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac 361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc 421 tcaacttaag ggtggtgcta agaaggtctg // ------------------------------------------------------------------------------- 2.1. LOCUS line The format of LOCUS line in the flat file is shown below; --------- -------- Positions Contents --------- -------- 01-05 'LOCUS' 06-12 spaces 13-28 Locus name 29-29 space 30-40 Length of sequence, right-justified 41-41 space 42-43 'bp' 44-47 spaces 48-54 DNA, RNA, mRNA, rRNA, tRNA or cRNA, left justified 55-55 space 56-63 'linear' followed by two spaces, or 'circular' 64-64 space 65-67 The division code (see '3.1. Division categories') 68-68 space 69-79 Date, in the form dd-MMM-yyyy (e.g., 08-JUL-2002) ------------------------------------------------------------------------------ 2.2. DEFINITION line The definition briefly describes the information of gene(s). "DEFINITION" is constructed by each of the three data banks. 2.3. ACCESSION line This line shows accession number of the entry data. A unique accession number is issued to the data submitter by each of the three data banks. The accession number is composed of 1 alphabet character and 5 digits (ex. A12345) or 2 alphabet characters and 6 digits (ex. AB123456). The former style was used in 1980s, but later the latter style was introduced because of data explosion. All the entries designated by the accession numbers with the prefixes given below have been collected and processed by DDBJ, and the rest have been done by GenBank and EMBL/EBI. ------------------------------------------------------------------------------- C, D, E, AB, AG, AK, AP, AT, AU, AV, BA, BB, BD, BJ, BP, BR, BS, BW, BY, CI, CJ, DA, DB, DC, DD, DE, DF, DG, DH, DI, DJ, DK, DL, DM ------------------------------------------------------------------------------- You can find the list of the prefixes of the accession numbers at the following URL; http://www.ddbj.nig.ac.jp/sub/prefix.html If multiple entries are united to an entry, or if an entry is extensively modified after the submission, the responsible data banks may assign a new accession number to it. In these cases, the new accession number is called the primary accession number, and the old accession number(s) is/are called the secondary accession number(s). In the flat file, the primary accession number is indicated first, then the secondary accession number(s) follows. You can find the same updated entry with both the primary and the secondary accession numbers. 2.4. VERSION line This line consists of an accession number and a version number, like "AB123456.1", in which the digit(s) after the period is a version number. The data open to public for the first time is version number as "1". The reason for adding VERSION is that since a released sequence sometimes revised by the submitter, the accession number alone cannot specify the sequence in question causing the user a trouble. The number is increased by one every time when a revised sequence is made public. 2.5. KEYWORDS line The data banks describe this line, if necessary. In many cases, the categories of the data (EST, HTG etc.), gene names and product names included in "KEYWORDS". 2.6. SOURCE line This line shows the scientific name on organism from which the sequence is obtained and an organelle type if the sequence is derived from an organelle other than the nucleus. 2.7. REFERENCE line The information on the submitters and references related to the submitted sequence is indicated in REFERENCE line. 2.8. COMMENT line. The information about an entry that can not be described using FEATURES or the other fields. 2.9. FEATURES line Biological features of a submitted sequence data are described with "Feature" key (the biological nature of the annotated feature), "Location" (the region of the sequence which corresponds to Feature), and "Qualifier" (supplementary information about Feature). The "Feature" and "Qualifier" keys used in the present release is defined by DDBJ/EMBL/GenBank Feature Table: Definition (Version 8.0 October, 2008). The document is continuously updated every half year. You can find its newest version on URL; http://www.ddbj.nig.ac.jp/FT/full_index.html 2.10. BASE COUNT line In the BASE COUNT line of the DDBJ flat file, 9 digits are allocated for each number of a (adenine), c (cytosine), g(guanine) and t (thymine). In the case of RNA sequence, uracil is indicated as "t" according to the rule of the international nucleotide database. In accordance with the relaxation of sequence length limitation, GenBank had already dropped the BASE COUNT line from their flat file format from GenBank Release 138 (Oct. 2003). DDBJ has decided to maintain the BASE COUNT line in our flat file format from the view that GC contents are still important information to characterize the sequence. 2.11. ORIGIN line The sequence data starts from the next line of ORIGIN. The sequence is indicated as lower case letters, delimited by space per 10 bases, starts a new line by 60 bases. The numbers described at left side of lines mean the ordinal number of the top base of the line. 3. Dataset categories There have been a number of genome projects going on worldwide. Among them human genome projects have probably been most productive and yielded a large number of ordinary sequences, huge amounts of genome sequences and EST (expressed sequence tags). Thus, we DDBJ have the human (HUM) division solely for human sequences and the primate (PRI) division for non-human primate sequences, while PRI division of GenBank database contains human sequences too. Note that the other divisions such as EST, GSS, and HTC may also contain human sequences. The present release is divided into 22 categories of organisms and others. See also '6. File categories' and '9. File list' below. The contents of the 22 categories are shown in the following. 3.1. Division categories The first 21 divisions are given below; HUM; human PRI; primates (other than human) ROD; rodents MAM; mammals (other than primates and rodents) VRT; vertebrates (other than mammals) INV; invertebrates (animals other than vertebrates) PLN; plants, fungi, plastids (eukaryotes other than animals) BCT; bacteria (including both Eubacteria and Archaea) VRL; viruses PHG; bacteriophages ENV; sequences obtained via environmental sampling methods SYN; synthetic constructs EST; expressed sequence tags; short single pass cDNA sequences GSS; genome survey sequences; short single pass genomic sequences TSA; transcriptome shotgun assemblies HTC; high throughput cDNA sequences; The sequence submitted from cDNA sequencing projects except for EST. This division is to include unfinished high throughput cDNA sequences, each of which has 5'UTR and 3'UTR at both ends and part of a coding region. The sequence may also include introns. When the sequence becomes finished later, it moves to the corresponding taxonomic division. HTG; high throughput genomic sequences The sequence submitted mainly from genome sequencing projects which regarded a clone as a sequencing unit. STS; sequence tagged sites The tag site for genome sequencing. The information of chromosome, map, PCR_condition is mandatory for this division. PAT; sequence data related to patent application The data those which the Japanese Patent Office (JPO), United States Patent and Trademark Office (USPTO), the European Patent Office (EPO), and Korean Intellectual Property Office (KIPO) collected, processed and released. See also '3.3. Notice for patent related sequence data' below. UNA; the data not annotated The UNA division is not used for recently submitted sequences. CON; Contig / Constructed To conjugate a series of entries, such as those submitted from a genome project, each of the three data banks constructs an entry and assign an accession number to a large scale sequence dataset. Such entries are classified into the CON division. The entry in the CON division has the information of joined accession numbers instead of the sequence data. The corresponding entries of the CON entry have been submitted to other divisions. The entries and bases in the CON division are not counted in the released numbers given on the top of the release note. 3.2. TPA separated from primary dataset TPA (Third Party Annotation) data are also available. The TPA data are a complement to the existing DDBJ/EMBL/GenBank comprehensive database of primary nucleotide sequences, which typically result from direct sequencing of cDNAs, ESTs, genomic DNAs etc. Primary entries are defined to be data for which the submitting group has done the sequencing and annotation, and as 'owner' of these data has privileges to submit updates/corrections etc. Primary entries used to build a TPA sequence are those that have been experimentally determined and are publicly available in the DDBJ/EMBL/GenBank databases. They may not be from a proprietary database. The entries and bases in TPA are not counted in the released numbers given on the top of the release note. See also the following URLs; http://www.ddbj.nig.ac.jp/sub/tpa-e.html http://www.insdc.org/TPA.html 3.3. Notice for patent related sequence data This release includes PAT division for patent related sequence data as described above. The data those which Japanese Patent Office (JPO), United States Patent and Trademark Office (USPTO), European Patent Office (EPO), and Korean Intellectual Property Office (KIPO) collected, processed and released. The prefixes of accession numbers for the patent related sequence data are shown below; ----------------------------------- JPO : E, BD, DD, DJ, DL, DM KIPO : DI USPTO: I, AR, DZ, EA, GC, GP EPO : A, AX, CQ, CS, FB, GM, GN ----------------------------------- Note also that unauthorized use of the patented data may cause legal issues for which DDBJ takes no responsibility. 4. DDBJ staff This release is published by the following DDBJ staff. Gojobori T, Takagi T, Tateno Y, Sugawara H, Saitou N, Okubo K, Nakamura Y, Ikeo K, Suzuki Y, Fukuchi S, Sumiyama K, Ogasawara O, Aono H, Ehara Y, Ejima M, Fukuda D, Gojobori M, Hashimoto T, Hirai T, Hirata F, Hoshi N, Hosokawa T, Ikesaka T, Ikezawa H, Iwazaki H, Kawahara S, Kawamoto T, Kazama T, Kodachi W, Kodama Y, Kohira J, Koike T, Kosuge T, Kurihara T, Kusakabe A, Lee K, Maki M, Mamiya H, Mashima J, Murakata N, Nagai I, Nagira S, Nagura M, Nakanishi T, Nozaki A, Okido T, Sakai K, Sugita R, Takashima E, Tanabe W, Tsutsui H, Yamada H, Yamamoto K, Yamamoto M, and Yokoyama E Center for Information Biology and DNA Data Bank of Japan National Institute of Genetics Research Organization of Information and Systems Mishima 411-8540, Japan Phone: +81 55 981 6853 FAX: +81 55 981 6849 E-mail: ddbj@ddbj.nig.ac.jp (for general inquiry) ddbjsub@ddbj.nig.ac.jp (for data submission) ddbjupdt@ddbj.nig.ac.jp (for updates and notification of publication) WWW: http://www.ddbj.nig.ac.jp/ (for DDBJ WWW server) http://sakura.ddbj.nig.ac.jp/ (for DDBJ sequence data submission system) 5. Acknowledgment We are grateful to NCBI and EMBL/EBI for a firm friendship and an excellent collaboration with us. We also thank the Japanese Patent Office for a steady cooperation with us. The operation of DDBJ is supported by the Ministry of Education, Culture, Sports, Science and Technology, and we would gratefully note this here. DDBJ uses the Super-SINET computer network for data collection, data exchange and various services. 6. File categories This release covers 22 categories (see also '3. Dataset categories'.) of organisms and others as follows: ------------------------------------------------------------------------------ ddbjbct; Category for bacteria ddbjcon; Category for CON (contig sequences) ddbjenv; Category for ENV (environmental samples) ddbjest; Category for EST (expressed sequence tags) ddbjgss; Category for GSS (genome survey sequences) ddbjhtc; Category for HTC (high throughput cDNA sequences) ddbjhtg; Category for HTG (high throughput genomic sequences) ddbjhum; Category for human ddbjinv; Category for invertebrates ddbjmam; Category for mammals other than primates and rodents ddbjpat; Category for patents ddbjphg; Category for phages ddbjpln; Category for plants ddbjpri; Category for primates other than human ddbjrod; Category for rodents ddbjsts; Category for STS (sequence tagged sites) ddbjsyn; Category for synthetic DNAs ddbjtpa; Category for TPA (third party annotation) ddbjtsa; Category for TSA (transcriptome shotgun assemblies) ddbjuna; Category for unannotated sequences ddbjvrl; Category for viruses ddbjvrt; Category for vertebrates other than mammals ------------------------------------------------------------------------------ Some of above in the present release are recorded in multiple ddbj***###.seq files, each of which at most has 1.5 GB storage capacity as follows, respectively. --------------------- ddbjbct : 6 files ddbjenv : 2 files ddbjest : 132 files ddbjgss : 49 files ddbjhtc : 2 files ddbjhtg : 21 files ddbjhum : 5 files ddbjinv : 3 files ddbjpat : 11 files ddbjpln : 6 files ddbjpri : 2 files ddbjrod : 5 files ddbjsts : 3 files ddbjvrl : 2 files ddbjvrt : 3 files ddbjcon : 20 files --------------------- The index files included in this release are ddbjacc#.idx, ddbjgen.idx, ddbjjou#.idx, and ddbjkey#.idx. See also '9. File list'. All of them except ddbjgen.idx are recorded in multiple ddbj***#.idx files, each of which at most has 1.5 GB storage capacity. 7. Sample of the contents in each file 7.1. Part of the contents in the file 'ddbjbct1.seq' This shows all pieces of information on one entry in DDBJ format. ------------------------------------------------------------------------------ LOCUS D87069 993 bp mRNA linear BCT 05-OCT-2006 DEFINITION Escherichia coli mRNA for RNA polymerase sigma subunit, truncated form of sigma-38, complete cds. ACCESSION D87069 VERSION D87069.1 KEYWORDS RNA polymerase sigma subunit, truncated form of sigma-38. SOURCE Escherichia coli ORGANISM Escherichia coli Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; Enterobacteriaceae; Escherichia. REFERENCE 1 (bases 1 to 993) AUTHORS Jishage,M. TITLE Direct Submission JOURNAL Submitted (14-AUG-1996) to the DDBJ/EMBL/GenBank databases. Contact:Miki Jishage National Institute of Genetics, Molecular Genetics; Yata 1111, Mishima, Shizuoka 411, Japan REFERENCE 2 (bases 1 to 993) AUTHORS Jishage,M. and Ishihama,A. TITLE Variation in RNA polymerase sigma subunit composition within different stocks of Escherichia coli starin W3110 JOURNAL Unpublished (1996) REFERENCE 3 AUTHORS Ivanova,A., Renshaw,M., Guntaka,R. and Eisenstark,A. TITLE DNA base sequence variability in katF (putative sigma factor) gene Escherichia coli JOURNAL Nucleic Acids Res. 20, 5479-5480 (1992) REFERENCE 4 AUTHORS Takayanagi,Y., Tanaka,K. and Takahashi,H. TITLE Structure of the 5' upstream region and the regulation of the rpoS gene of Escherichia coli JOURNAL Mol. Gen. Genet. 243, 525-531 (1994) COMMENT FEATURES Location/Qualifiers source 1..993 /db_xref="taxon:562" /mol_type="mRNA" /organism="Escherichia coli" /strain="W3110" CDS 1..810 /note="the gene has four single base changes, resulting in two amino acid substitutions and an amber mutation" /product="RNA polymerase sigma subunit, truncated form of sigma-38" /protein_id="BAA13238.1" /transl_table=11 /translation="MSQNTLKVHDLNEDAEFDENGVEVFDEKALVEYEPSDNDLAEEE LLSQGATQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLV VKIARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMN QTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNER ITSVDTPLGGDSEKALLDILADEKENGPEDTTQDDDMKQSIVKWLFELNAK" variation 75 /citation=[3] /replace="t" variation 97 /citation=[3] /replace="t" variation 99 /citation=[3] /replace="t" variation 808 /citation=[3] /replace="t" BASE COUNT 254 a 223 c 291 g 225 t ORIGIN 1 atgagtcaga atacgctgaa agttcatgat ttaaatgaag atgcggaatt tgatgagaac 61 ggagttgagg tttttgacga aaaggcctta gtagaatatg aacccagtga taacgatttg 121 gccgaagagg aactgttatc gcagggagcc acacagcgtg tgttggacgc gactcagctt 181 taccttggtg agattggtta ttcaccactg ttaacggccg aagaagaagt ttattttgcg 241 cgtcgcgcac tgcgtggaga tgtcgcctct cgccgccgga tgatcgagag taacttgcgt 301 ctggtggtaa aaattgcccg ccgttatggc aatcgtggtc tggcgttgct ggaccttatc 361 gaagagggca acctggggct gatccgcgcg gtagagaagt ttgacccgga acgtggtttc 421 cgcttctcaa catacgcaac ctggtggatt cgccagacga ttgaacgggc gattatgaac 481 caaacccgta ctattcgttt gccgattcac atcgtaaagg agctgaacgt ttacctgcga 541 accgcacgtg agttgtccca taagctggac catgaaccaa gtgcggaaga gatcgcagag 601 caactggata agccagttga tgacgtcagc cgtatgcttc gtcttaacga gcgcattacc 661 tcggtagaca ccccgctggg tggtgattcc gaaaaagcgt tgctggacat cctggccgat 721 gaaaaagaga acggtccgga agataccacg caagatgacg atatgaagca gagcatcgtc 781 aaatggctgt tcgagctgaa cgccaaatag cgtgaagtgc tggcacgtcg attcggtttg 841 ctggggtacg aagcggcaac actggaagat gtaggtcgtg aaattggcct cacccgtgaa 901 cgtgttcgcc agattcaggt tgaaggcctg cgccgtttgc gcgaaatcct gcaaacgcag 961 gggctgaata tcgaagcgct gttccgcgag taa // ------------------------------------------------------------------------------ 7.2. Part of the contents in the accession number index file 'ddbjacc1.idx' The following excerpt from the accession number index file illustrates the format of the index. ------------------------------------------------------------------------------ D00001 ECPBPA BCT X04516 D00002 ECPYRC BCT X04469 D00003 HUMP450M HUM D00003 D00004 FLBFLBL40 VRL D00004 D00005 IBAMEM682 VRL D00005 D00006 BACPNS1981 BCT D00006 D00007 CHKCALGRP VRT D00007 D00008 ECPNTAB BCT X04195 D00009 DROPER1 INV D00009 ------------------------------------------------------------------------------ 7.3. Part of the contents in the keyword phrase index file 'ddbjkey1.idx' Keyword phrases consist of names for gene products and other characteristics of sequence entries. ------------------------------------------------------------------------------ "COAT PROTEIN SMO511347 VRL AJ511347 'TNPA GENE UBA564903 BCT AJ564903 'ZINC-FINGER' MOTIF PRNS53 VRL X60546 (+) MATING TYPE SURFACE PROTEIN ABGPSSP PLN M94861 (1,3 TABETGLUB PLN Z22874 (1,3)-BETA-D-GLUCAN BINDING PROTEIN AJ606470 INV AJ606470 (1,3)BETA-GLUCAN SYNTHASE NCU09275 PLN U09275 (1,4)-BETA-D-ARABINOXYLAN ARABINOFURANOHYDROLASE ANAXHA PLN Z78011 ANTUAXHA PLN Z78010 (1,6)-BETA-GLUCAN BIOSYNTHESIS YSAKRE1A PLN M81588 (1-3)-BETA-GLUCANASE NTSP41AGN PLN X81560 PA13BGPT PLN X57794 (1-3,1-4)-BETA-D-GLUCANASE HVBDG PLN X52572 (1-4)-BETA-MANNAN ENDOHYDROLASE CAR278996 PLN AJ278996 CAR293305 PLN AJ293305 (2',5'-OLIGOISOADENYLATE SYNTHETASE-DEPENDENT) AL138776 HUM AL138776 (2'-5') OLIGO(A) SYNTHASE E16 SSO4G06 EST F14610 (2'-5')OLIGOADENYLATE SYNTHETASE HSA225089 HUM AJ225089 HUMSYN25A HUM D00068 SSA225090 MAM AJ225090 (6')-IB' AMINOGLYCOSIDE ACETYLTRANSFERASE AXY278514 BCT AJ278514 PAE291609 BCT AJ291609 (8,11)-LINOLEOYL DESATURASE COF245938 PLN AJ245938 ------------------------------------------------------------------------------ 7.4. Part of the contents in the journal citation index file 'ddbjjou1.idx' The journal citation index file lists all of the citations that appear in the references. ------------------------------------------------------------------------------ (ER) AAPS PHARMSCI. 4 (3), DOI 10.1208/PS040315 (2002) AY170916 ROD AY170916 (ER) AM. J. HUM. GENET. 76 (1) (2004) IN PRESS AY753209S1 HUM AY753209 AY753209S2 HUM AY753210 (ER) ARCH. VIROL. (2004) IN PRESS AF531505 VRL AF531505 AY518899 VRL AY518899 AY518900 VRL AY518900 AY518901 VRL AY518901 AY518902 VRL AY518902 AY518903 VRL AY518903 AY518904 VRL AY518904 AY518905 VRL AY518905 AY518906 VRL AY518906 AY518907 VRL AY518907 AY518908 VRL AY518908 AY518909 VRL AY518909 AY518910 VRL AY518910 AY518911 VRL AY518911 AY518912 VRL AY518912 AY518913 VRL AY518913 AY518914 VRL AY518914 AY518915 VRL AY518915 AY518916 VRL AY518916 AY518917 VRL AY518917 AY518918 VRL AY518918 AY518919 VRL AY518919 AY518920 VRL AY518920 AY518921 VRL AY518921 AY518922 VRL AY518922 AY518923 VRL AY518923 AY518924 VRL AY518924 AY518925 VRL AY518925 AY518926 VRL AY518926 AY518927 VRL AY518927 AY518928 VRL AY518928 AY518929 VRL AY518929 AY518930 VRL AY518930 AY518931 VRL AY518931 AY518932 VRL AY518932 AY521234 VRL AY521234 AY521235 VRL AY521235 AY521236 VRL AY521236 AY521237 VRL AY521237 AY521238 VRL AY521238 (ER) ARTERIOSCLER. THROMB. VASC. BIOL. (2004) IN PRESS AY563557 HUM AY563557 (ER) BIOCHEM. BIOPHYS. RES. COMMUN. 325 (1), 203-214 (2004) AY563137 HUM AY563137 (ER) BIOCHEM. J./10.1042/BJ20030293 HSA496460 HUM AJ496460 ------------------------------------------------------------------------------ 7.5. Part of the contents in the gene name index file 'ddbjgen.idx' This file lists all the gene names that appear in the feature table. ------------------------------------------------------------------------------ 'ARR BX927156 BCT BX927156 'BGLG BX927156 BCT BX927156 'BGLS BX927148 BCT BX927148 'BGLY' BX927156 BCT BX927156 'BRNQ AF305888 BCT AF305888 'COMK AL591983 BCT AL591983 AL596172 BCT AL596172 'CRCB BX927155 BCT BX927155 'CRTI BX927155 BCT BX927155 'DPPE LDDIPEP BCT Z34898 'FIC BX936398 BCT BX936398 ------------------------------------------------------------------------------ 8. Release history Release Date Entries Bases Comments 77 03/09 102,099,156 101,765,388,414 76 12/08 98,220,409 98,741,908,446 75 09/08 92,840,037 95,219,505,205 TSA division started 74 06/08 87,903,140 91,294,770,939 73 03/08 83,167,582 86,099,950,395 KIPO inclusion started 72 12/07 79,004,098 82,592,245,487 Most of E-mail addresses discarded 71 09/07 76,273,345 79,706,204,461 70 06/07 72,801,679 76,788,510,646 69 03/07 67,523,680 71,775,679,500 PROJECT line started Indexes for categories terminated 68 12/06 64,267,978 68,259,314,742 1.5 GB storage started 67 09/06 61,144,621 65,443,024,193 66 06/06 58,176,628 62,945,843,881 65 03/06 55,890,995 60,564,721,635 TPA subcategories started 64 12/05 52,272,669 56,098,558,378 Some index files split 63 09/05 47,741,593 52,246,110,341 62 06/05 45,249,444 49,158,155,283 ENV division started Version for release note started 61 03/05 43,118,204 47,099,081,750 Changed style of release note 60 12/04 40,583,945 44,416,752,273 /db_xref="H-inv:**" started 59 09/04 37,926,117 42,245,956,937 58 06/04 34,917,581 39,812,635,108 57 03/04 32,693,678 38,008,449,840 56 12/03 30,405,173 36,079,046,032 55 09/03 27,753,140 34,280,225,489 54 06/03 25,149,821 32,162,041,177 53 02/03 23,250,813 29,711,299,332 52 12/02 20,354,812 26,931,456,316 51 09/02 18,401,358 22,782,404,136 TPA started 50 06/02 17,260,693 20,158,357,982 49 04/02 16,503,157 18,579,627,226 48 01/02 15,016,100 16,197,713,855 47 10/01 13,266,610 14,145,671,645 46 07/01 12,313,759 13,037,646,166 45 04/01 11,434,113 12,207,092,905 HTC division started 44 01/01 10,165,597 11,136,298,841 43 10/00 8,666,551 10,034,532,698 42 07/00 7,554,995 8,880,721,093 41 04/00 5,962,608 6,409,581,885 CON division started 40 01/00 5,388,125 4,762,696,173 RNA division terminated 39 10/99 4,810,773 3,728,000,562 NID and PID discarded 38 07/99 4,294,369 3,098,519,597 37 03/99 3,311,627 2,375,261,951 VERSION, /protein_id started 36 01/99 3,073,166 2,190,425,560 35 10/98 2,759,261 1,957,341,169 34 07/98 2,412,785 1,708,580,623 33 04/98 2,174,769 1,479,303,279 32 01/98 1,956,669 1,300,950,613 31 10/97 1,731,532 1,139,869,464 Adoption of the unified taxonomy database 30 07/97 1,534,115 992,788,339 NID and PID terminated 29 04/97 1,270,194 841,415,232 28 01/97 1,154,120 756,785,219 HTG division started ORG division terminated 27 10/96 936,697 608,103,057 GSS division started 26 07/96 835,552 551,932,448 25 04/96 744,490 499,300,364 /translation started 24 01/96 637,508 431,771,652 23 10/95 569,757 390,694,350 22 07/95 437,588 322,982,425 HUM division started 21 04/95 274,596 250,875,023 20 01/95 239,689 231,299,557 19 10/94 204,332 205,274,131 18 07/94 185,230 192,473,021 17 04/94 169,957 179,942,209 16 01/94 154,626 165,017,628 15 10/93 131,649 147,224,690 14 07/93 120,350 138,686,333 JPO inclusion started 13 04/93 112,067 129,784,445 12 01/93 97,683 120,815,244 EST division started 11 07/92 65,693 84,839,075 10 01/92 59,317 77,805,556 GenBank/EMBL inclusion started 9 07/91 1,130 2,002,124 8 01/91 879 1,573,442 7 07/90 681 1,154,211 6 01/90 496 841,236 5 07/89 395 679,378 4 01/89 302 535,985 3 07/88 230 345,850 2 01/88 142 199,392 1 07/87 66 108,970 Started with DDBJ only ------------------ Since release 75 ------------------ A new division for assembled mRNA sequences, Transcriptome Shotgun Assembly (TSA), has been included since the release 75. With new sequencing technologies in use, INSDC have faced many requests to accept assembled EST sequences. These sequence data have become more useful than used to be, although they may not be correctly assembled or exist in nature. Therefore, INSDC decided to collect assembled EST sequences and classified them into the new division 'TSA'. TSA sequences are shotgun assemblies of primary sequences deposited in the EST division of INSDC, race Archive (TA) or Short-Read Archive (SRA). Two specific keywords, "TSA" and "Transcriptome Shotgun Assembly", are present in all TSA entries. The new division code, "TSA", is also described in the the LOCUS line in all TSA entries. No format changes in the flat file are anticipated for the TSA division, however, note that TSA entries make use of the same PRIMARY line that is described for the entries in TPA category (See also '3.2. TPA separated from primary dataset'). The PRIMARY block contains references to the underlying reads/transcripts that are assembled to construct a TSA record. Note that it is required for a TSA submission to submit sequence data of primary transcripts to the EST division of INSDC, TA, or SRA. More information about how to submit a TSA entry is provided via the following URL; http://www.ddbj.nig.ac.jp/sub/tsa-e.html ------------------ Since release 73 ------------------ Introduction of the sequence data from the Korean Intellectual Property Office: The nucleotide sequence data transferred from Korean Intellectual Property Office (KIPO) have been included in DDBJ release. See also, '3.1. Division categories' and '3.3. Notice for patent related sequence data'. ------------------ Since release 72 ------------------ Deletion of E-mail address, phone and fax numbers from DDBJ flat file: To follow the Japanese law of protecting personal information, DDBJ deleted both phone and fax numbers, and E-mail address from the flat files of the entries submitted to DDBJ. It would be also helpful to protect DDBJ releases against SPAM mail senders. DDBJ retrofitted most of all entries submitted to DDBJ, not to GenBank or EMBL, by the DDBJ periodical release 72. Previously, the submitter information was described in JOURNAL line at REFERENCE 1 as, -------------------------------------------------------------------------------- REFERENCE 1 (bases 1 to 1200) AUTHORS Mishima,T. TITLE Direct Submission JOURNAL Submitted (01-Jan-1990) to the DDBJ/EMBL/GenBank databases. Taro Mishima, DNA Data Bank of Japan, National Institute of Genetics; 1111, Yata, Mishima, Shizuoka 411-8540, Japan (E-mail:ddbj@ddbj.nig.ac.jp, URL:http://www.ddbj.nig.ac.jp/, Tel:81-12-345-6789, Fax:81-12-345-9876) -------------------------------------------------------------------------------- After the deletion or the information in question, DDBJ flat file is either one of the following two types; Type 1: Phone and fax numbers and E-mail address are deleted. -------------------------------------------------------------------------------- REFERENCE 1 (bases 1 to 1200) AUTHORS Mishima,T. TITLE Direct Submission JOURNAL Submitted (01-Jan-1990) to the DDBJ/EMBL/GenBank databases. Contact:Taro Mishima DNA Data Bank of Japan, National Institute of Genetics; 1111, Yata, Mishima, Shizuoka 411-8540, Japan URL :http://www.ddbj.nig.ac.jp/ ------------------------------------------------------------------------------- Type 2: When the submitters wish to keep their contact information disclosed, it is described as, ------------------------------------------------------------------------------- REFERENCE 1 (bases 1 to 1200) AUTHORS Mishima,T. TITLE Direct Submission JOURNAL Submitted (01-Jan-1990) to the DDBJ/EMBL/GenBank databases. Contact:Taro Mishima DNA Data Bank of Japan, National Institute of Genetics; 1111, Yata, Mishima, Shizuoka 411-8540, Japan URL :http://www.ddbj.nig.ac.jp/ E-mail :ddbj@ddbj.nig.ac.jp Phone :81-12-345-6789 Fax :81-12-345-9876 ------------------------------------------------------------------------------- ------------------ Since release 69 ------------------ Introduction of the project ID at PROJECT line in DDBJ flat file: Following the agreement at the INSD collaborative meeting in 2006, INSDC has started to assign the project ID for submissions from sequencing projects. The description of project ID is shown as below; ---------------------------------------------------------------------------- A unique identifier, assigned at the time of the submission by a sequencing project that informed INSDC of the submission beforehand. It is recommended that the submitter quotes the assigned project ID in all communication with INSDC databases to allow for easier and faster tracking of issues. The project ID field provides an umbrella identifier that points to all related sequence data for the project. ---------------------------------------------------------------------------- The PROJECT lines contain INSDC-assigned ID for the sequencing project. It will be appeared between VERSION and KEYWORDS lines in DDBJ flat files, from the DDBJ periodical release, 69 as shown below. See also '2. DDBJ flat file format'. ---------------------------------------------------------------------------- ACCESSION AB012345 VERSION AB012345.1 PROJECT GenomeProject:123 KEYWORDS . ---------------------------------------------------------------------------- Termination of providing the index files for each category: For users logging in one of our computers (supernig), we provided index files for each category. However, as the computer system in our institute was replaced with a new one which does not have a service using the index files, we terminated providing the index files. ------------------ Since release 68 ------------------ Split of files: We changed the maximum file size from 300 MB to 1.5 GB, because the network capacity has been remarkably increased. Each file named as ddbj***##.seq has at most 1.5 GB storage capacity. See also the sections, '6. File categories' and '9. File list'. ------------------ Since release 65 ------------------ Introduction of two types of TPA entries: According to the decision of ICM 2005, TPA data set is now classified into two categories, "TPA:experimental" and "TPA:inferential", to distinguish TPA annotation supported by wet-lab. experimental evidence and that inferred. The retrofit to divide TPA entries into two categories starts from the release 65. You can find the description of the two TPA categories at the following URLs; http://www.ddbj.nig.ac.jp/sub/tpa-e.html http://www.insdc.org/TPA.html See also '3.2. TPA separated from primary dataset'. ------------------ Since release 64 ------------------ Split of index files: In the present release, some of index files (ddbjacc.idx, ddbjjou.idx, and ddbjkey.idx) have been greater than 2 GB in the file size. So, these have been recorded in multiple ddbj****.idx files, each of which at most has 1.5 GB storage capacity as follows, respectively. See also 6., 7.2., 7.3., 7.4. and 9. ------------------ Since release 62 ------------------ Release version number is introduced: DDBJ has started to include the item, 'version', for its release note, which indicates a version for its periodical release. It is expressed like '62.0', in which the digit(s) after the period is a version number. The reason for adding the version number is that a released data is sometimes revised due to urgent and necessary corrections. The number is increased by one every time when a revised periodical release is made public until the next release. Introduction of ENV division: Recently, the submissions of the sequences derived from environmental samples have rapidly increased. To accommodate such submissions, a new division, ENV, has been created (See also '3.1. Division categories'). This division contains the sequences obtained via direct molecular isolation such as PCR, DGGE, or any anonymous method. In the past, the sequences derived from environmental samples belonged to taxonomic divisions, mainly BCT. At DDBJ, the retrofit to transfer relevant entries from taxonomic divisions to the ENV division starts in the present release, and ends by the next periodical release. Please note that during this transitional period, some entries to be eventually placed in the ENV division will be found in other divisions. Strand information is removed: The strand information of LOCUS line in the flat file has been removed as shown below. See also '2.1. LOCUS line'. ---------------------------------------------------------------------------- Old (-rel. 61): 44-44 space 45-47 spaces, ss- (single-stranded), ds- (double-stranded), or ms- (mixed-stranded) New (rel. 62-): 44-47 spaces ---------------------------------------------------------------------------- ------------------ Since release 61 ------------------ The style of release note (this file) has been changed. Some entries have the sequential format for the secondary accession numbers in the ACCESSION line, in order to make the expression of secondary accession numbers in the past short. For example; ------------------------------------------------------------------------------ Before; ACCESSION AB000802 D85885 D85886 D85887 After; ACCESSION AB000802 D85885-D85887 ------------------------------------------------------------------------------ See also '2.3. ACCESSION line'. ------------------ Since release 60 ------------------ The cross-reference to the H-invitational has been included. ------------------ Since release 56 ------------------ The three data banks have agreed that the maximum length limitation (350 kb) of a submitted sequence be relaxed. The BASE COUNT line of the DDBJ flat file format has been changed, corresponding to the relaxation of the maximum sequence length restriction in the entry that had been practiced at DDBJ/EMBL/GenBank International Nucleotide Sequence Databases. In the BASE COUNT line of the DDBJ flat file, 6 digits had been allocated for each number of a, c, g, t and other bases in the sequence. Hereafter, in the new flat file format, 9 digits are allocated for each number of a, c, g and t, while the numbers of other bases are removed. In accordance with the relaxation of sequence length limitation, GenBank had already dropped the BASE COUNT line from their flat file format from GenBank Release 138 (Oct. 2003). We DDBJ have decided to maintain the BASE COUNT line in our flat file format from the view that GC contents are still important information to characterize the sequence. The changes in the BASE COUNT line are shown below. ---------------------------------------------------------------------------- Old (-rel. 55): 1 6 11 16 21 26 31 36 41 46 51 56 61 66 71 |----|----|----|----|----|----|----|----|----|----|----|----|----|----| BASE COUNT 123456 a 123456 c 123456 g 123456 t 123456 others New (rel. 56-): 1 6 11 16 21 26 31 36 41 46 51 56 61 66 71 |----|----|----|----|----|----|----|----|----|----|----|----|----|----| BASE COUNT 123456789 a 123456789 c 123456789 g 123456789 t ---------------------------------------------------------------------------- The SOURCE in the flat file is revisited and revised if necessary in accordance with the unified taxonomy database common to the three data banks. ------------------ Since release 54 ------------------ '/sequenced_mol' qualifier has been changed to '/mol_type' qualifier. We accordingly completed retrofitting the pertinent entries. This change was made on the agreement at the INSD collaborative meeting in 2002. ------------------ Since release 51 ------------------ The TPA (Third Party Annotation) dataset has been available. The dataset is a complement to the existing DDBJ/EMBL/GenBank database of the primary nucleotide sequences which were obtained from direct sequencing of cDNAs, ESTs, genomic DNAs etc. The format of LOCUS line in the flat file has been changed as shown below to adjust to the GenBank format. ------------------------------------------------------------------------------ Old (-rel. 50): LOCUS AB000001 660 bp DNA PLN 01-FEB-2001 New (rel. 51-): LOCUS AB000001 660 bp DNA linear PLN 01-FEB-2001 ------------------------------------------------------------------------------ ------------------ Since release 45 ------------------ The HTC (High Throughput cDNA) division has been included. This is to include unfinished high throughput cDNA sequences, each of which has 5'UTR and 3'UTR at both ends and part of a coding region. The sequence may also include introns. When the sequence becomes finished later, it moves to the corresponding taxonomic division. The sequence is accompanied with a keyword, HTC (High Throughput cDNA), which is dropped when the sequence is finished and moved to a taxonomic division. ------------------ Since release 41 ------------------ The CON division has been included. This division is to show the order of related sequences in a genome, and expressed by join and the accession numbers of the sequences. The contents of the CON division are compiled by the three data banks not by the data submitter. ------------------ Since release 40 ------------------ The RNA division was terminated. The RNA data have been redistributed according to the category of the organism. Therefore, you will find a human RNA sequence, for example, in the HUM division. ------------------ Since release 37 ------------------ The three data banks include the item VERSION in the flat file, which indicates a version of a submitted nucleotide sequence. It is expressed like AB123456.1, in which the digit(s) after the period is a version number. The reason for adding VERSION is that since a released sequence sometimes revised by the submitter, the accession number alone cannot specify the sequence in question causing the user a trouble. The number is increased by one every time when a revised sequence is made public. Accordingly, the translated protein sequence will be accompanied with a /protein_id which is expressed as BAA12345.1, in which the digit(s) after the period is again a version number. The number is increased by one when the corresponding nucleotide sequence is revised and the protein sequence is changed as a result, and when the revised protein sequence is made public. ------------------ Since release 31 ------------------ We have started adopting the unified taxonomy database to unify the biological source of the sequence. The database is made up with scientific names, ID of unidentified organisms, and synthetic constructs etc. ------------------ Since release 30 ------------------ NID and PID were terminated. This change was made on the agreement at the INSD collaborative meeting in 1999. ------------------ Since release 28 ------------------ The HTG (High Throughput Genomic sequence) has been included. This division was created to cope with genome project teams which deal with a clone as a sequencing unit. We terminated the ORG (Organelle) division. Thus, if you are interested in human mitochondrial sequences, for example, you are now advised to refer to the HUM division. ------------------ Since release 27 ------------------ The GSS division has been included. GSS stands for Genome Survey Sequence, which is similar to EST, except that GSS is genomic DNA whereas EST is cDNA. ------------------ Since release 25 ------------------ DDBJ release contains amino acid sequences that were translated from the corresponding nucleotide sequences of the database. In the translation we paid much attention to the fact that some species or organella have a codon different from the universal one, and used the proper codon table. ------------------ Since release 22 ------------------ The HUM division has been included. Human genome projects have probably been most productive and yielded a large number of sequences Thus, we have the human (HUM) division solely for human sequences and the primate (PRI) division for non-human primate sequences. ------------------ Since release 12 ------------------ The EST (Expressed Sequence Tag) division has been included. The number of ESTs has been increasing at an enormous rate and is expected to be growing even more rapidly in the future. Thus, we created a division for ESTs ------------------ Since release 10 ------------------ The sequences submitted to GenBank or EMBL have been included in the release. 9. File list The files in this release are arranged in the following order with non-labeled format. ----------------------------------------------------------------------- file name file size ----------------------------------------------------------------------- ddbjrel.txt (DDBJ release note) 72567 ddbjacc1.idx (Accession number index file 1) 1499999967 ddbjacc2.idx (Accession number index file 2) 1500000006 ddbjacc3.idx (Accession number index file 3) 983346298 ddbjgen.idx (Gene name index file) 144542699 ddbjjou1.idx (Journal citation index file 1) 1499960119 ddbjjou2.idx (Journal citation index file 2) 1447255489 ddbjjou3.idx (Journal citation index file 3) 1251933288 ddbjkey1.idx (Keyword phrase index file 1) 464318467 ddbjkey2.idx (Keyword phrase index file 2) 1763484599 ddbjkey3.idx (Keyword phrase index file 3) 1496504616 ddbjkey4.idx (Keyword phrase index file 4) 352692918 ----------------------------------------------------------------------- file name number of entries number of bases file size ----------------------------------------------------------------------- ddbjbct1.seq 122873 613523259 1499001665 ddbjbct2.seq 94202 627572477 1499878226 ddbjbct3.seq 327 680367397 1502344975 ddbjbct4.seq 354 663524472 1508251279 ddbjbct5.seq 654 659797466 1502671902 ddbjbct6.seq 225378 409449927 1146103131 ddbjenv1.seq 587463 395618937 1499001250 ddbjenv2.seq 445952 399716908 1286495001 ddbjest1.seq 462669 173118679 1499002183 ddbjest2.seq 490456 191879518 1499000109 ddbjest3.seq 497987 205916887 1499000623 ddbjest4.seq 479823 204811330 1499003009 ddbjest5.seq 549783 296417272 1499000590 ddbjest6.seq 562617 339729883 1499000887 ddbjest7.seq 540558 306936192 1499001106 ddbjest8.seq 388611 120891508 1499005277 ddbjest9.seq 495599 213590274 1499002003 ddbjest10.seq 513751 237396779 1499001068 ddbjest11.seq 473274 200571746 1499000532 ddbjest12.seq 358989 127415518 1499000043 ddbjest13.seq 274387 83711679 1499003078 ddbjest14.seq 274766 108804948 1499003048 ddbjest15.seq 390241 182489350 1499001255 ddbjest16.seq 481521 250868952 1499000828 ddbjest17.seq 461835 242795182 1499000431 ddbjest18.seq 449440 244774203 1499001462 ddbjest19.seq 466402 230123273 1499002038 ddbjest20.seq 461315 278143303 1499003536 ddbjest21.seq 473586 286738596 1499002617 ddbjest22.seq 465435 242308811 1499000185 ddbjest23.seq 446885 263261349 1499003125 ddbjest24.seq 516078 284140936 1499000795 ddbjest25.seq 539433 315344090 1499000702 ddbjest26.seq 414215 207932996 1499001208 ddbjest27.seq 432283 261307811 1499003256 ddbjest28.seq 479889 267581302 1499001293 ddbjest29.seq 516670 257831743 1499000057 ddbjest30.seq 450251 241517032 1499002474 ddbjest31.seq 453616 256565528 1499000099 ddbjest32.seq 443169 292790219 1499003227 ddbjest33.seq 409659 289176471 1499003187 ddbjest34.seq 515889 309130517 1499000530 ddbjest35.seq 623953 357302686 1499000077 ddbjest36.seq 463740 298299942 1499001055 ddbjest37.seq 410308 235286134 1499005826 ddbjest38.seq 258676 96645462 1499002544 ddbjest39.seq 258228 105738957 1499000256 ddbjest40.seq 329411 161166622 1499000208 ddbjest41.seq 471941 267990216 1499003773 ddbjest42.seq 484200 269789488 1499000121 ddbjest43.seq 448945 240873702 1499001152 ddbjest44.seq 495931 284650679 1499001232 ddbjest45.seq 496072 258869019 1499001416 ddbjest46.seq 443395 254397083 1499000299 ddbjest47.seq 545525 285521240 1499000021 ddbjest48.seq 434530 251943933 1499001207 ddbjest49.seq 381958 215857098 1499004566 ddbjest50.seq 261993 132192489 1499003471 ddbjest51.seq 266885 108184794 1499001577 ddbjest52.seq 313892 139918642 1499003362 ddbjest53.seq 426554 242473028 1499000211 ddbjest54.seq 549560 310032239 1499000373 ddbjest55.seq 429227 286391899 1499001764 ddbjest56.seq 441285 243478722 1499000315 ddbjest57.seq 476639 280294703 1499001265 ddbjest58.seq 442096 239420619 1499001363 ddbjest59.seq 463484 266902964 1499001398 ddbjest60.seq 459150 274910436 1499000637 ddbjest61.seq 418091 246182445 1499002144 ddbjest62.seq 501592 330761804 1499002011 ddbjest63.seq 436626 269738336 1499003083 ddbjest64.seq 450374 231686429 1499002685 ddbjest65.seq 442620 274578986 1499002774 ddbjest66.seq 431130 276831779 1499001565 ddbjest67.seq 366545 243749779 1499000892 ddbjest68.seq 446721 240955225 1499003150 ddbjest69.seq 419309 234680666 1499001177 ddbjest70.seq 426783 235673928 1499002968 ddbjest71.seq 445100 238651417 1499000585 ddbjest72.seq 513929 300975412 1499002030 ddbjest73.seq 520485 317631895 1499003827 ddbjest74.seq 584582 335143431 1499003017 ddbjest75.seq 458253 281447441 1499000474 ddbjest76.seq 399791 304828719 1499003285 ddbjest77.seq 505663 290866017 1499000861 ddbjest78.seq 399733 284716948 1499002585 ddbjest79.seq 379085 253528100 1499001167 ddbjest80.seq 378470 270355503 1499002218 ddbjest81.seq 424063 298408651 1499004124 ddbjest82.seq 430126 316038309 1499000131 ddbjest83.seq 468716 309767000 1499001040 ddbjest84.seq 461883 296256593 1499001057 ddbjest85.seq 543215 247797565 1499000104 ddbjest86.seq 565017 269251508 1499000009 ddbjest87.seq 479001 309970581 1499002171 ddbjest88.seq 520963 304101666 1499001761 ddbjest89.seq 573784 320687908 1499001053 ddbjest90.seq 619828 258417673 1499001329 ddbjest91.seq 533737 307600232 1498999973 ddbjest92.seq 496033 302861803 1499000607 ddbjest93.seq 562716 223772531 1499000687 ddbjest94.seq 525267 289700496 1499001124 ddbjest95.seq 475400 300338355 1499002557 ddbjest96.seq 426764 242398321 1499000620 ddbjest97.seq 669744 142928020 1499000566 ddbjest98.seq 450508 303291176 1499001514 ddbjest99.seq 574789 225151228 1499000656 ddbjest100.seq 493502 300298175 1499001423 ddbjest101.seq 508209 312770535 1499001273 ddbjest102.seq 531775 281250035 1499001655 ddbjest103.seq 583528 217510858 1499001358 ddbjest104.seq 505292 301163357 1499001006 ddbjest105.seq 414548 276930796 1499003153 ddbjest106.seq 479249 287304488 1499000612 ddbjest107.seq 444354 292535042 1499001477 ddbjest108.seq 484090 366245057 1499002901 ddbjest109.seq 417261 266756770 1499002638 ddbjest110.seq 405839 274384359 1499003494 ddbjest111.seq 463945 282747101 1499002942 ddbjest112.seq 448362 295718917 1499003422 ddbjest113.seq 482648 277346541 1499000242 ddbjest114.seq 366391 226477036 1499001424 ddbjest115.seq 468459 241249511 1499001930 ddbjest116.seq 494257 274593873 1499000823 ddbjest117.seq 399084 254531496 1499000452 ddbjest118.seq 479913 290838869 1499002776 ddbjest119.seq 388133 255634682 1499004528 ddbjest120.seq 360879 208158358 1499002127 ddbjest121.seq 454745 113592833 1498999951 ddbjest122.seq 664315 335998893 1499001551 ddbjest123.seq 433222 266835268 1499002167 ddbjest124.seq 497772 266956050 1499001197 ddbjest125.seq 477033 98441972 1499000085 ddbjest126.seq 455137 91274792 1499002430 ddbjest127.seq 474668 291608701 1499002119 ddbjest128.seq 446107 295005327 1499000132 ddbjest129.seq 428898 299071731 1499001999 ddbjest130.seq 484939 189537203 1499000361 ddbjest131.seq 464427 191631733 1499000628 ddbjest132.seq 107621 42729430 349898245 ddbjgss1.seq 482984 349305268 1499003202 ddbjgss2.seq 446069 340598840 1498999960 ddbjgss3.seq 446214 336243434 1499001337 ddbjgss4.seq 564446 274032854 1499002174 ddbjgss5.seq 488061 252350707 1499001466 ddbjgss6.seq 465697 255644208 1499003538 ddbjgss7.seq 389421 193265522 1499002123 ddbjgss8.seq 418388 210929316 1499003030 ddbjgss9.seq 500046 291240405 1499001306 ddbjgss10.seq 557526 311326683 1499001664 ddbjgss11.seq 497667 293090491 1498999934 ddbjgss12.seq 535633 351110533 1499002989 ddbjgss13.seq 522299 366309248 1499002051 ddbjgss14.seq 515484 355316140 1498999963 ddbjgss15.seq 607431 340296733 1498999959 ddbjgss16.seq 605712 371949994 1499000003 ddbjgss17.seq 566298 315102170 1499001924 ddbjgss18.seq 523004 376473534 1499002077 ddbjgss19.seq 512054 342245089 1499001787 ddbjgss20.seq 603676 387547921 1499002616 ddbjgss21.seq 586409 417760389 1499001809 ddbjgss22.seq 537085 312319581 1499001336 ddbjgss23.seq 479596 289141477 1499001608 ddbjgss24.seq 520783 347840189 1499001903 ddbjgss25.seq 532381 339110715 1499002327 ddbjgss26.seq 538362 343226763 1499002429 ddbjgss27.seq 607308 298670729 1499002120 ddbjgss28.seq 554812 264959638 1499000666 ddbjgss29.seq 538387 377809014 1499000439 ddbjgss30.seq 476760 329093488 1499000889 ddbjgss31.seq 485631 379059741 1499002665 ddbjgss32.seq 556339 356831816 1499000102 ddbjgss33.seq 529998 340722620 1499001267 ddbjgss34.seq 482868 344132797 1499000424 ddbjgss35.seq 538826 303727739 1499002006 ddbjgss36.seq 526386 313068085 1498999923 ddbjgss37.seq 514145 262075615 1499004737 ddbjgss38.seq 413050 335184682 1499000133 ddbjgss39.seq 419050 346493062 1499002801 ddbjgss40.seq 426686 341418058 1499003437 ddbjgss41.seq 419614 346132883 1499002176 ddbjgss42.seq 426410 345971082 1499000787 ddbjgss43.seq 420873 340029365 1499001659 ddbjgss44.seq 463389 343203937 1499000262 ddbjgss45.seq 508205 335516531 1499000131 ddbjgss46.seq 617961 391789947 1499002258 ddbjgss47.seq 599161 417920487 1499001515 ddbjgss48.seq 551620 395956327 1499003040 ddbjgss49.seq 365573 186325396 1166939121 ddbjhtc1.seq 279949 357293743 1499002061 ddbjhtc2.seq 252220 251934262 894705509 ddbjhtg1.seq 11401 1118219667 1499038996 ddbjhtg2.seq 7562 1118339327 1499102639 ddbjhtg3.seq 5898 1130910795 1499182587 ddbjhtg4.seq 5457 1140257240 1499205660 ddbjhtg5.seq 5297 1144404145 1499193295 ddbjhtg6.seq 5347 1144445597 1499385492 ddbjhtg7.seq 6530 1132553370 1499151281 ddbjhtg8.seq 6881 1142735598 1499046951 ddbjhtg9.seq 6287 1139616384 1499029841 ddbjhtg10.seq 6295 1133242066 1499159279 ddbjhtg11.seq 7007 1124752539 1499001878 ddbjhtg12.seq 7025 1123759728 1499016529 ddbjhtg13.seq 6933 1142023653 1499187200 ddbjhtg14.seq 7020 1135309985 1499006569 ddbjhtg15.seq 6833 1141704739 1499072327 ddbjhtg16.seq 6456 1139968363 1499193153 ddbjhtg17.seq 6473 1138942716 1499053602 ddbjhtg18.seq 7733 1148879312 1499056736 ddbjhtg19.seq 6132 1134475732 1499069483 ddbjhtg20.seq 6827 1155514130 1499157152 ddbjhtg21.seq 5162 802619674 1044576225 ddbjhum1.seq 28563 1049902603 1499080528 ddbjhum2.seq 8116 1069566488 1499020756 ddbjhum3.seq 146063 822530617 1499131111 ddbjhum4.seq 21880 1068810747 1499014800 ddbjhum5.seq 271299 538623367 1481864114 ddbjinv1.seq 233734 705733232 1501273463 ddbjinv2.seq 448511 433195813 1499002884 ddbjinv3.seq 67128 131408909 341052256 ddbjmam.seq 179557 478405387 1010137640 ddbjpat1.seq 1035383 520101148 1499001321 ddbjpat2.seq 776722 494038580 1499000993 ddbjpat3.seq 744946 347076778 1499000335 ddbjpat4.seq 696493 602502560 1499000927 ddbjpat5.seq 739891 390558576 1499001702 ddbjpat6.seq 737897 333823653 1499000406 ddbjpat7.seq 773779 435394321 1498999932 ddbjpat8.seq 877974 587530277 1499000857 ddbjpat9.seq 1098112 386809952 1499093155 ddbjpat10.seq 888458 499820852 1499001922 ddbjpat11.seq 376900 224963268 637734422 ddbjphg.seq 4152 33202335 81286916 ddbjpln1.seq 158889 857886088 1499000738 ddbjpln2.seq 205902 605571381 1499015863 ddbjpln3.seq 54522 931747427 1514101692 ddbjpln4.seq 261872 640125409 1499059506 ddbjpln5.seq 420693 495618204 1499001834 ddbjpln6.seq 299512 273665329 931199190 ddbjpri1.seq 49092 1079995736 1499195395 ddbjpri2.seq 20070 61439742 121379284 ddbjrod1.seq 34140 1020376048 1499032771 ddbjrod2.seq 5893 1092809804 1499069227 ddbjrod3.seq 41055 1053174101 1499010322 ddbjrod4.seq 78016 896162426 1499136302 ddbjrod5.seq 203002 108505646 483845776 ddbjsts1.seq 417439 210844732 1499000273 ddbjsts2.seq 339628 238934436 1499000460 ddbjsts3.seq 550303 178084209 1444845886 ddbjsyn.seq 86460 123908190 448509859 ddbjtsa.seq 51641 23426202 111077962 ddbjuna.seq 281 478940 1367316 ddbjvrl1.seq 395616 406514428 1499139191 ddbjvrl2.seq 249945 276142012 981230265 ddbjvrt1.seq 244918 662338742 1499006830 ddbjvrt2.seq 50929 1053192734 1499225835 ddbjvrt3.seq 244376 545701796 1215945782 ------------------------------------------------------------------------------ Total 102099156 101765388414 370481568398 ddbjtpa.seq 6356 25368704 53626782 ddbjcon1.seq 683246 0 1498959846 ddbjcon2.seq 222193 0 1499000471 ddbjcon3.seq 361084 0 1499000087 ddbjcon4.seq 571214 0 1499458275 ddbjcon5.seq 572616 0 1499000338 ddbjcon6.seq 365569 0 1499134993 ddbjcon7.seq 445721 0 1499003348 ddbjcon8.seq 303363 0 1499370305 ddbjcon9.seq 234177 0 1499002234 ddbjcon10.seq 227601 0 1499001593 ddbjcon11.seq 258323 0 1499005372 ddbjcon12.seq 258596 0 1499001519 ddbjcon13.seq 287427 0 1499002538 ddbjcon14.seq 321571 0 1499002278 ddbjcon15.seq 272395 0 1499002024 ddbjcon16.seq 269228 0 1499001161 ddbjcon17.seq 272804 0 1499000896 ddbjcon18.seq 269225 0 1499000408 ddbjcon19.seq 249583 0 1499001704 ddbjcon20.seq 82410 0 503411355 The entries and bases in the CON division and TPA dataset are not counted in the numbers given on the top of the release note or 'Total' on the above table.