DNA Data Bank of Japan DNA Database Release 80.0, Dec. 2009, including 112,314,250 entries, 109,636,862,252 bases Last published date in the present release: November 20, 2009 ------------------------------------------------------------------------------- Table of contents ------------------------------------------------------------------------------- 1. Introduction 1.1. Announcement for changes in the present release 1.2. Announcement for the forthcoming changes 2. DDBJ flat file format 2.1. LOCUS line 2.2. DEFINITION line 2.3. ACCESSION line 2.4. VERSION line 2.5. KEYWORDS line 2.6. SOURCE line 2.7. REFERENCE line 2.8. COMMENT line 2.9. FEATURES line 2.10. BASE COUNT line 2.11. ORIGIN line 3. Dataset categories 3.1. Division categories 3.2. TPA separated from primary dataset 3.3. Notice for patent related sequence data 4. DDBJ staff 5. Acknowledgment 6. File categories 7. Sample of the contents in each file 7.1. Part of the contents in the file 'ddbjbct1.seq' 7.2. Part of the contents in the accession number index file 'ddbjacc1.idx' 7.3. Part of the contents in the keyword phrase index file 'ddbjkey1.idx' 7.4. Part of the contents in the journal citation index file 'ddbjjou1.idx' 7.5. Part of the contents in the gene name index 'ddbjgen.idx' 8. Release history 9. File list ------------------------------------------------------------------------------- 1. Introduction The present release contains the newest data prepared by the DNA Data Bank of Japan (DDBJ), GenBank (*), and EMBL-Bank/European Bioinformatics Institute (EMBL-Bank/EBI) as of November 20, 2009. This unified database was made possible thanks to the international collaboration among the three data banks. All the entries have accordingly been annotated using the feature keys common to them. In 2005, DDBJ, EMBL-Bank and GenBank agreed to call their collaboration "the International Nucleotide Sequence Database Collaboration (INSDC); http://www.insdc.org " and to call the unified nucleotide sequence database "the International Nucleotide Sequence Database (INSD)". *'GenBank' is a trademark of NIH, USA, and is operated by National Center for Biotechnology Information (NCBI) at NIH. This database may be copied and redistributed without permission on the condition that all the statements in this release note are reproduced in each copy. See also '3.3. Notice for patent related sequence data' below. 1.1. Announcement for changes in the present release The format of the SOURCE line in DDBJ flat file has been changed: As results of this change, 1) the order of organism name and organelle name is changed and 2) some of DDBJ flat files have included a common name like as GenBank flat files. The change is shown below in detail. ---------------- Old (-rel. 79) ---------------- Format: SOURCE [] Example: SOURCE Homo sapiens mitochondrion ---------------- New (rel. 80-) ---------------- Format: SOURCE [] [()] Example: SOURCE mitochondrion Homo sapiens (human) See also '2. DDBJ flat file format'. 1.2. Announcement for the forthcoming changes TPA category data will be excluded from DDBJ periodical release: Since September 2002 (DDBJ release 51), we have provided DDBJ periodical releases including TPA category data. However, it is potentially confusing for users, because TPA category is not primary nucleotide sequence data. Therefore, DDBJ will terminate to include TPA data in the next periodical release. Please note that we will continue to provide TPA category data released from INSDC independently of DDBJ periodical release at following DDBJ FTP site. FTP site for TPA data: ftp://ftp.ddbj.nig.ac.jp/ddbj_database/tpa/ See also '3. Dataset categories', '3.2. TPA separated from primary dataset' and '6. File categories'. 2. DDBJ flat file format The database is a collection of "entry" which is the unit of the data. The entries submitted to databanks were processed and publicized according to the DDBJ format for distribution (flat file). The flat file includes the sequence and the information of submitters, references, source organisms, and "feature" information, etc. The items of the DDBJ flat file are explained at following; ------------------------------------------------------------------------------- LOCUS AB000000 450 bp mRNA linear HUM 08-JUL-2002 DEFINITION Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds. ACCESSION AB000000 VERSION AB000000.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 450) AUTHORS Mishima,H. and Shizuoka,T. TITLE Direct Submission JOURNAL Submitted (30-NOV-2000) to the DDBJ/EMBL/GenBank databases. Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; 1111, Yata, Mishima, Shizuoka 411-8540, Japan REFERENCE 2 AUTHORS Mishima,H., Shizuoka,T. and Fuji,I. TITLE Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver JOURNAL Unpublished (2002) COMMENT Human cDNA sequencing project. FEATURES Location/Qualifiers source 1..450 /chromosome="12" /clone="GT200015" /clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)" /map="12p13" /mol_type="mRNA" /organism="Homo sapiens" /tissue_type="liver" CDS 86..>450 /codon_start=1 /gene="GAPD" /product="glyceraldehyde-3-phosphate dehydrogenase" /protein_id="BAA12345.1" /transl_table=1 /translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV" BASE COUNT 102 a 119 c 131 g 98 t ORIGIN 1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct 61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg 121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc 181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt 241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg 301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac 361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc 421 tcaacttaag ggtggtgcta agaaggtctg // ------------------------------------------------------------------------------- 2.1. LOCUS line The format of LOCUS line in the flat file is shown below; --------- -------- Positions Contents --------- -------- 01-05 'LOCUS' 06-12 spaces 13-28 Locus name 29-29 space 30-40 Length of sequence, right-justified 41-41 space 42-43 'bp' 44-47 spaces 48-54 DNA, RNA, mRNA, rRNA, tRNA or cRNA, left justified 55-55 space 56-63 'linear' followed by two spaces, or 'circular' 64-64 space 65-67 The division code (see '3.1. Division categories') 68-68 space 69-79 Date, in the form dd-MMM-yyyy (e.g., 08-JUL-2002) ------------------------------------------------------------------------------ 2.2. DEFINITION line The definition briefly describes the information of gene(s). "DEFINITION" is constructed by each of the three data banks. 2.3. ACCESSION line This line shows accession number of the entry data. A unique accession number is issued to the submitter of sequence data by each of the three data banks. The accession number is composed of 1 alphabet character and 5 digits (ex. A12345) or 2 alphabet characters and 6 digits (ex. AB123456). The former style was used in 1980s, but later the latter style was introduced because of data explosion. All the entries designated by the accession numbers with the prefixes given below have been collected and processed by DDBJ, and the rest have been done by GenBank and EMBL-Bank/EBI. ------------------------------------------------------------------------------- C, D, E, AB, AG, AK, AP, AT, AU, AV, BA, BB, BD, BJ, BP, BR, BS, BW, BY, CI, CJ, DA, DB, DC, DD, DE, DF, DG, DH, DI, DJ, DK, DL, DM, FS, FT ------------------------------------------------------------------------------- You can find the list of the prefixes of the accession numbers at the following URL; http://www.ddbj.nig.ac.jp/sub/prefix.html If multiple entries are united to an entry, or if an entry is extensively modified after the submission, the responsible data banks may assign a new accession number to it. In these cases, the new accession number is called the primary accession number, and the old accession number(s) is/are called the secondary accession number(s). In the flat file, the primary accession number is indicated first, then the secondary accession number(s) follows. You can find the same updated entry with both the primary and the secondary accession numbers. 2.4. VERSION line This line consists of an accession number and a version number, like "AB123456.1", in which the digit(s) after the period is a version number. The data open to public for the first time is version number as "1". The reason for adding VERSION is that since a released sequence sometimes revised by the submitter, the accession number alone cannot specify the sequence in question causing the user a trouble. The number is increased by one every time when a revised sequence is made public. 2.5. KEYWORDS line The data banks describe this line, if necessary. In many cases, the categories of the data (EST, HTG etc.), gene names and product names included in "KEYWORDS". 2.6. SOURCE line This line shows the scientific name (and a corresponding common name, if defined as "Genbank common name" in taxonomy database) on organism from which the sequence is obtained and an organelle type if the sequence is derived from an organelle other than the nucleus. 2.7. REFERENCE line The information on the submitters and references related to the submitted sequence is indicated in REFERENCE line. 2.8. COMMENT line. The information about an entry that cannot be described using FEATURES or the other fields. 2.9. FEATURES line Biological features of a submitted sequence data are described with "Feature" key (the biological nature of the annotated feature), "Location" (the region of the sequence which corresponds to Feature), and "Qualifier" (supplementary information about Feature). The "Feature" and "Qualifier" keys used in the present release is defined by DDBJ/EMBL/GenBank Feature Table: Definition Version 8.2 (December, 2009). The document is continuously updated every half year. You can find its newest version on URL; http://www.ddbj.nig.ac.jp/FT/full_index.html 2.10. BASE COUNT line In the BASE COUNT line of the DDBJ flat file, 9 digits are allocated for each number of a (adenine), c (cytosine), g(guanine) and t (thymine). In the case of RNA sequence, uracil is indicated as "t" according to the rule of the international nucleotide database. 2.11. ORIGIN line The sequence data starts from the next line of ORIGIN. The sequence is indicated as lower case letters, delimited by space per 10 bases, starts a new line by 60 bases. The numbers described at left side of lines mean the ordinal number of the top base of the line. 3. Dataset categories There have been a number of genome projects going on worldwide. Among them human genome projects have probably been most productive and yielded a large number of ordinary sequences, huge amounts of genome sequences and EST (expressed sequence tags). Thus, we DDBJ have the human (HUM) division solely for human sequences and the primate (PRI) division for non-human primate sequences, while PRI division of GenBank database contains human sequences too. Note that the other divisions such as EST, GSS, and HTC may also contain human sequences. The present release is divided into 22 categories of organisms and others. See also '6. File categories' and '9. File list' below. The contents of the 22 categories are shown in the following. 3.1. Division categories The first 21 divisions are given below; HUM; human PRI; primates (other than human) ROD; rodents MAM; mammals (other than primates and rodents) VRT; vertebrates (other than mammals) INV; invertebrates (animals other than vertebrates) PLN; plants, fungi, plastids (eukaryotes other than animals) BCT; bacteria (including both Eubacteria and Archaea) VRL; viruses PHG; bacteriophages ENV; sequences obtained via environmental sampling methods SYN; synthetic constructs (artificially constructed sequences) EST; expressed sequence tags; short single pass cDNA sequences GSS; genome survey sequences; short single pass genomic sequences TSA; transcriptome shotgun assemblies HTC; high throughput cDNA sequences; The sequence submitted from cDNA sequencing projects except for EST. This division is to include unfinished high throughput cDNA sequences, each of which has 5'UTR and 3'UTR at both ends and part of a coding region. The sequence may also include introns. When the sequence becomes finished later, it moves to the corresponding taxonomic division. HTG; high throughput genomic sequences The sequence submitted mainly from genome sequencing projects which regarded a clone as a sequencing unit. STS; sequence tagged sites The tag site for genome sequencing. The information of chromosome, map, is mandatory for this division. PAT; sequence data related to patent application The data those which the Japanese Patent Office (JPO), United States Patent and Trademark Office (USPTO), the European Patent Office (EPO), and Korean Intellectual Property Office (KIPO) collected, processed and released. See also '3.3. Notice for patent related sequence data' below. UNA; the data not annotated The UNA division is not used for recently submitted sequences. CON; Contig / Constructed To conjugate a series of entries, such as those submitted from a genome project, each of the three data banks constructs an entry and assign an accession number to a large scale sequence dataset. Such entries are classified into the CON division. The entry in the CON division has the information of joined accession numbers instead of the sequence data. The corresponding entries of the CON entry have been submitted to other divisions. The entries and bases in the CON division are not counted in the released numbers given on the top of the release note. 3.2. TPA separated from primary dataset TPA (Third Party Annotation) data are also available. The TPA data are a complement to the existing DDBJ/EMBL-Bank/GenBank comprehensive database of primary nucleotide sequences, which typically result from direct sequencing of cDNAs, ESTs, genomic DNAs etc. Primary entries are defined to be data for which the submitting group has done the sequencing and annotation, and as 'owner' of these data has privileges to submit updates/corrections etc. Primary entries used to build a TPA sequence are those that have been experimentally determined and are publicly available in the DDBJ/EMBL-Bank/ GenBank databases. They may not be from a proprietary database. The entries and bases in TPA are not counted in the released numbers given on the top of the release note. See also the following URLs; http://www.ddbj.nig.ac.jp/sub/tpa-e.html http://www.insdc.org/TPA.html 3.3. Notice for patent related sequence data This release includes PAT division for patent related sequence data as described above. The data those which Japanese Patent Office (JPO), United States Patent and Trademark Office (USPTO), European Patent Office (EPO), and Korean Intellectual Property Office (KIPO) collected, processed and released. The prefixes of accession numbers for the patent related sequence data are shown below; ---------------------------------------------- JPO : E, BD, DD, DJ, DL, DM KIPO : DI USPTO: I, AR, DZ, EA, GC, GP EPO : A, AX, CQ, CS, FB, GM, GN, HA, HB, HC ---------------------------------------------- Note also that unauthorized use of the patented data may cause legal issues for which DDBJ takes no responsibility. 4. DDBJ staff This release is published by the following DDBJ staff. Jun Mashima, Hideo Aono, Yoshiyuki Ehara, Mayumi Ejima, Masato Endo, Masahiro Fujimoto, Daisuke Fukuda, Mariko Gojobori, Tatsukazu Hashimoto, Tomohiro Hirai, Fumie Hirata, Nobuhiro Hoshi, Tsutomu Ikesaka, Fumiyasu Ishikawa, Kazuya Kanno, Shingo Kawahara, Tatsuko Kawamoto, Takahiro Kazama, Satoshi Kitadate, Wataru Kodachi, Yuichi Kodama, Junko Kohira, Tomohiro Koike, Takehide Kosuge, Fumiko Kubodera, Kyungbum Lee, Mika Maki, Haruka Mamiya, Hisako Mashima, Kimiko Mimura, Naoko Murakata, Sachiko Nagira, Masahiko Nagura, Asami Nozaki, Toshihisa Okido, Katsunaga Sakai, Satoshi Saruhashi, Makoto Sato, Yukie Shinyama, Naoki Shiraishi, Rie Sugita, Kimiko Suzuki, Kazuya Takei, Wataru Tanabe, Haru Tsutsui,Hiroaki Yamada, Keisuke Yamamoto, Kenji Yamamoto, Makoto Yamamoto, Emi Yokoyama, Takashi Gojobori, Eli Kaminuma, Osamu Ogasawara, Kosaku Okubo, Toshihisa Takagi and Yasukazu Nakamura Center for Information Biology and DNA Data Bank of Japan National Institute of Genetics Research Organization of Information and Systems Mishima 411-8540, Japan Phone: +81 55 981 6853 FAX: +81 55 981 6849 E-mail: ddbj@ddbj.nig.ac.jp (for general inquiry) ddbjsub@ddbj.nig.ac.jp (for data submission) ddbjupdt@ddbj.nig.ac.jp (for updates and notification of publication) WWW: http://www.ddbj.nig.ac.jp/ (for DDBJ WWW server) http://sakura.ddbj.nig.ac.jp/ (for DDBJ sequence data submission system) 5. Acknowledgment We are grateful to NCBI and EBI for a firm friendship and an excellent collaboration with us. We also thank the Japanese Patent Office for a steady cooperation with us. The operation of DDBJ is supported by the Ministry of Education, Culture, Sports, Science and Technology, and we would gratefully note this here. DDBJ uses the Super-SINET computer network for data collection, data exchange and various services. 6. File categories This release covers 22 categories (see also '3. Dataset categories'.) of organisms and others as follows: ------------------------------------------------------------------------------ ddbjbct; Category for bacteria ddbjcon; Category for CON (contig sequences) ddbjenv; Category for ENV (environmental samples) ddbjest; Category for EST (expressed sequence tags) ddbjgss; Category for GSS (genome survey sequences) ddbjhtc; Category for HTC (high throughput cDNA sequences) ddbjhtg; Category for HTG (high throughput genomic sequences) ddbjhum; Category for human ddbjinv; Category for invertebrates ddbjmam; Category for mammals other than primates and rodents ddbjpat; Category for patents ddbjphg; Category for phages ddbjpln; Category for plants ddbjpri; Category for primates other than human ddbjrod; Category for rodents ddbjsts; Category for STS (sequence tagged sites) ddbjsyn; Category for synthetic DNAs ddbjtpa; Category for TPA (third party annotation) ddbjtsa; Category for TSA (transcriptome shotgun assemblies) ddbjuna; Category for unannotated sequences ddbjvrl; Category for viruses ddbjvrt; Category for vertebrates other than mammals ------------------------------------------------------------------------------ Some of above in the present release are recorded in multiple ddbj***###.seq files, each of which at most has 1.5 GB storage capacity as follows, respectively. --------------------- ddbjbct : 7 files ddbjenv : 4 files ddbjest : 139 files ddbjgss : 54 files ddbjhtc : 2 files ddbjhtg : 22 files ddbjhum : 6 files ddbjinv : 3 files ddbjpat : 14 files ddbjpln : 6 files ddbjpri : 2 files ddbjrod : 5 files ddbjsts : 3 files ddbjvrl : 3 files ddbjvrt : 4 files ddbjcon : 20 files --------------------- The index files included in this release are ddbjacc#.idx, ddbjgen.idx, ddbjjou#.idx, and ddbjkey#.idx. See also '9. File list'. All of them except ddbjgen.idx are recorded in multiple ddbj***#.idx files, each of which at most has 1.5 GB storage capacity. 7. Sample of the contents in each file 7.1. Part of the contents in the file 'ddbjbct1.seq' This shows all pieces of information on one entry in DDBJ format. ------------------------------------------------------------------------------ LOCUS D87069 993 bp mRNA linear BCT 05-OCT-2006 DEFINITION Escherichia coli mRNA for RNA polymerase sigma subunit, truncated form of sigma-38, complete cds. ACCESSION D87069 VERSION D87069.1 KEYWORDS RNA polymerase sigma subunit, truncated form of sigma-38. SOURCE Escherichia coli ORGANISM Escherichia coli Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; Enterobacteriaceae; Escherichia. REFERENCE 1 (bases 1 to 993) AUTHORS Jishage,M. TITLE Direct Submission JOURNAL Submitted (14-AUG-1996) to the DDBJ/EMBL/GenBank databases. Contact:Miki Jishage National Institute of Genetics, Molecular Genetics; Yata 1111, Mishima, Shizuoka 411, Japan REFERENCE 2 AUTHORS Jishage,M. and Ishihama,A. TITLE Variation in RNA polymerase sigma subunit composition within different stocks of Escherichia coli starin W3110 JOURNAL Unpublished (1996) REFERENCE 3 AUTHORS Ivanova,A., Renshaw,M., Guntaka,R. and Eisenstark,A. TITLE DNA base sequence variability in katF (putative sigma factor) gene Escherichia coli JOURNAL Nucleic Acids Res. 20, 5479-5480 (1992) REFERENCE 4 AUTHORS Takayanagi,Y., Tanaka,K. and Takahashi,H. TITLE Structure of the 5' upstream region and the regulation of the rpoS gene of Escherichia coli JOURNAL Mol. Gen. Genet. 243, 525-531 (1994) COMMENT FEATURES Location/Qualifiers source 1..993 /db_xref="taxon:562" /mol_type="mRNA" /organism="Escherichia coli" /strain="W3110" CDS 1..810 /note="the gene has four single base changes, resulting in two amino acid substitutions and an amber mutation" /product="RNA polymerase sigma subunit, truncated form of sigma-38" /protein_id="BAA13238.1" /transl_table=11 /translation="MSQNTLKVHDLNEDAEFDENGVEVFDEKALVEYEPSDNDLAEEE LLSQGATQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLV VKIARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMN QTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNER ITSVDTPLGGDSEKALLDILADEKENGPEDTTQDDDMKQSIVKWLFELNAK" variation 75 /citation=[3] /replace="t" variation 97 /citation=[3] /replace="t" variation 99 /citation=[3] /replace="t" variation 808 /citation=[3] /replace="t" BASE COUNT 254 a 223 c 291 g 225 t ORIGIN 1 atgagtcaga atacgctgaa agttcatgat ttaaatgaag atgcggaatt tgatgagaac 61 ggagttgagg tttttgacga aaaggcctta gtagaatatg aacccagtga taacgatttg 121 gccgaagagg aactgttatc gcagggagcc acacagcgtg tgttggacgc gactcagctt 181 taccttggtg agattggtta ttcaccactg ttaacggccg aagaagaagt ttattttgcg 241 cgtcgcgcac tgcgtggaga tgtcgcctct cgccgccgga tgatcgagag taacttgcgt 301 ctggtggtaa aaattgcccg ccgttatggc aatcgtggtc tggcgttgct ggaccttatc 361 gaagagggca acctggggct gatccgcgcg gtagagaagt ttgacccgga acgtggtttc 421 cgcttctcaa catacgcaac ctggtggatt cgccagacga ttgaacgggc gattatgaac 481 caaacccgta ctattcgttt gccgattcac atcgtaaagg agctgaacgt ttacctgcga 541 accgcacgtg agttgtccca taagctggac catgaaccaa gtgcggaaga gatcgcagag 601 caactggata agccagttga tgacgtcagc cgtatgcttc gtcttaacga gcgcattacc 661 tcggtagaca ccccgctggg tggtgattcc gaaaaagcgt tgctggacat cctggccgat 721 gaaaaagaga acggtccgga agataccacg caagatgacg atatgaagca gagcatcgtc 781 aaatggctgt tcgagctgaa cgccaaatag cgtgaagtgc tggcacgtcg attcggtttg 841 ctggggtacg aagcggcaac actggaagat gtaggtcgtg aaattggcct cacccgtgaa 901 cgtgttcgcc agattcaggt tgaaggcctg cgccgtttgc gcgaaatcct gcaaacgcag 961 gggctgaata tcgaagcgct gttccgcgag taa // ------------------------------------------------------------------------------ 7.2. Part of the contents in the accession number index file 'ddbjacc1.idx' The following excerpt from the accession number index file illustrates the format of the index. ------------------------------------------------------------------------------ D00001 ECPBPA BCT X04516 D00002 ECPYRC BCT X04469 D00003 HUMP450M HUM D00003 D00004 FLBFLBL40 VRL D00004 D00005 IBAMEM682 VRL D00005 D00006 BACPNS1981 BCT D00006 D00007 CHKCALGRP VRT D00007 D00008 ECPNTAB BCT X04195 D00009 DROPER1 INV D00009 ------------------------------------------------------------------------------ 7.3. Part of the contents in the keyword phrase index file 'ddbjkey1.idx' Keyword phrases consist of names for gene products and other characteristics of sequence entries. ------------------------------------------------------------------------------ "COAT PROTEIN SMO511347 VRL AJ511347 'TNPA GENE UBA564903 BCT AJ564903 'ZINC-FINGER' MOTIF PRNS53 VRL X60546 (+) MATING TYPE SURFACE PROTEIN ABGPSSP PLN M94861 (1,3 TABETGLUB PLN Z22874 (1,3)-BETA-D-GLUCAN BINDING PROTEIN AJ606470 INV AJ606470 (1,3)BETA-GLUCAN SYNTHASE NCU09275 PLN U09275 (1,4)-BETA-D-ARABINOXYLAN ARABINOFURANOHYDROLASE ANAXHA PLN Z78011 ANTUAXHA PLN Z78010 (1,6)-BETA-GLUCAN BIOSYNTHESIS YSAKRE1A PLN M81588 (1-3)-BETA-GLUCANASE NTSP41AGN PLN X81560 PA13BGPT PLN X57794 (1-3,1-4)-BETA-D-GLUCANASE HVBDG PLN X52572 (1-4)-BETA-MANNAN ENDOHYDROLASE CAR278996 PLN AJ278996 CAR293305 PLN AJ293305 (2',5'-OLIGOISOADENYLATE SYNTHETASE-DEPENDENT) AL138776 HUM AL138776 (2'-5') OLIGO(A) SYNTHASE E16 SSO4G06 EST F14610 (2'-5')OLIGOADENYLATE SYNTHETASE HSA225089 HUM AJ225089 HUMSYN25A HUM D00068 SSA225090 MAM AJ225090 (6')-IB' AMINOGLYCOSIDE ACETYLTRANSFERASE AXY278514 BCT AJ278514 PAE291609 BCT AJ291609 (8,11)-LINOLEOYL DESATURASE COF245938 PLN AJ245938 ------------------------------------------------------------------------------ 7.4. Part of the contents in the journal citation index file 'ddbjjou1.idx' The journal citation index file lists all of the citations that appear in the references. ------------------------------------------------------------------------------ (ER) AAPS PHARMSCI. 4 (3), DOI 10.1208/PS040315 (2002) AY170916 ROD AY170916 (ER) AM. J. HUM. GENET. 76 (1) (2004) IN PRESS AY753209S1 HUM AY753209 AY753209S2 HUM AY753210 (ER) ARCH. VIROL. (2004) IN PRESS AF531505 VRL AF531505 AY518899 VRL AY518899 AY518900 VRL AY518900 AY518901 VRL AY518901 AY518902 VRL AY518902 AY518903 VRL AY518903 AY518904 VRL AY518904 AY518905 VRL AY518905 AY518906 VRL AY518906 AY518907 VRL AY518907 AY518908 VRL AY518908 AY518909 VRL AY518909 AY518910 VRL AY518910 AY518911 VRL AY518911 AY518912 VRL AY518912 AY518913 VRL AY518913 AY518914 VRL AY518914 AY518915 VRL AY518915 AY518916 VRL AY518916 AY518917 VRL AY518917 AY518918 VRL AY518918 AY518919 VRL AY518919 AY518920 VRL AY518920 AY518921 VRL AY518921 AY518922 VRL AY518922 AY518923 VRL AY518923 AY518924 VRL AY518924 AY518925 VRL AY518925 AY518926 VRL AY518926 AY518927 VRL AY518927 AY518928 VRL AY518928 AY518929 VRL AY518929 AY518930 VRL AY518930 AY518931 VRL AY518931 AY518932 VRL AY518932 AY521234 VRL AY521234 AY521235 VRL AY521235 AY521236 VRL AY521236 AY521237 VRL AY521237 AY521238 VRL AY521238 (ER) ARTERIOSCLER. THROMB. VASC. BIOL. (2004) IN PRESS AY563557 HUM AY563557 (ER) BIOCHEM. BIOPHYS. RES. COMMUN. 325 (1), 203-214 (2004) AY563137 HUM AY563137 (ER) BIOCHEM. J./10.1042/BJ20030293 HSA496460 HUM AJ496460 ------------------------------------------------------------------------------ 7.5. Part of the contents in the gene name index file 'ddbjgen.idx' This file lists all the gene names that appear in the feature table. ------------------------------------------------------------------------------ 'ARR BX927156 BCT BX927156 'BGLG BX927156 BCT BX927156 'BGLS BX927148 BCT BX927148 'BGLY' BX927156 BCT BX927156 'BRNQ AF305888 BCT AF305888 'COMK AL591983 BCT AL591983 AL596172 BCT AL596172 'CRCB BX927155 BCT BX927155 'CRTI BX927155 BCT BX927155 'DPPE LDDIPEP BCT Z34898 'FIC BX936398 BCT BX936398 ------------------------------------------------------------------------------ 8. Release history Release Date Entries Bases Comments 80 12/09 112,314,250 109,636,862,252 79 09/09 108,593,519 106,684,379,504 DBLINK line started PROJECT line terminated 78 06/09 105,737,359 104,597,360,291 77 03/09 102,099,156 101,765,388,414 76 12/08 98,220,409 98,741,908,446 75 09/08 92,840,037 95,219,505,205 TSA division started 74 06/08 87,903,140 91,294,770,939 73 03/08 83,167,582 86,099,950,395 KIPO inclusion started 72 12/07 79,004,098 82,592,245,487 Most of E-mail addresses discarded 71 09/07 76,273,345 79,706,204,461 70 06/07 72,801,679 76,788,510,646 69 03/07 67,523,680 71,775,679,500 PROJECT line started Indexes for categories terminated 68 12/06 64,267,978 68,259,314,742 1.5 GB storage started 67 09/06 61,144,621 65,443,024,193 66 06/06 58,176,628 62,945,843,881 65 03/06 55,890,995 60,564,721,635 TPA subcategories started 64 12/05 52,272,669 56,098,558,378 Some index files split 63 09/05 47,741,593 52,246,110,341 62 06/05 45,249,444 49,158,155,283 ENV division started Version for release note started 61 03/05 43,118,204 47,099,081,750 Changed style of release note 60 12/04 40,583,945 44,416,752,273 /db_xref="H-inv:**" started 59 09/04 37,926,117 42,245,956,937 58 06/04 34,917,581 39,812,635,108 57 03/04 32,693,678 38,008,449,840 56 12/03 30,405,173 36,079,046,032 55 09/03 27,753,140 34,280,225,489 54 06/03 25,149,821 32,162,041,177 53 02/03 23,250,813 29,711,299,332 52 12/02 20,354,812 26,931,456,316 51 09/02 18,401,358 22,782,404,136 TPA started 50 06/02 17,260,693 20,158,357,982 49 04/02 16,503,157 18,579,627,226 48 01/02 15,016,100 16,197,713,855 47 10/01 13,266,610 14,145,671,645 46 07/01 12,313,759 13,037,646,166 45 04/01 11,434,113 12,207,092,905 HTC division started 44 01/01 10,165,597 11,136,298,841 43 10/00 8,666,551 10,034,532,698 42 07/00 7,554,995 8,880,721,093 41 04/00 5,962,608 6,409,581,885 CON division started 40 01/00 5,388,125 4,762,696,173 RNA division terminated 39 10/99 4,810,773 3,728,000,562 NID and PID discarded 38 07/99 4,294,369 3,098,519,597 37 03/99 3,311,627 2,375,261,951 VERSION, /protein_id started 36 01/99 3,073,166 2,190,425,560 35 10/98 2,759,261 1,957,341,169 34 07/98 2,412,785 1,708,580,623 33 04/98 2,174,769 1,479,303,279 32 01/98 1,956,669 1,300,950,613 31 10/97 1,731,532 1,139,869,464 Adoption of the unified taxonomy database 30 07/97 1,534,115 992,788,339 NID and PID terminated 29 04/97 1,270,194 841,415,232 28 01/97 1,154,120 756,785,219 HTG division started ORG division terminated 27 10/96 936,697 608,103,057 GSS division started 26 07/96 835,552 551,932,448 25 04/96 744,490 499,300,364 /translation started 24 01/96 637,508 431,771,652 23 10/95 569,757 390,694,350 22 07/95 437,588 322,982,425 HUM division started 21 04/95 274,596 250,875,023 20 01/95 239,689 231,299,557 19 10/94 204,332 205,274,131 18 07/94 185,230 192,473,021 17 04/94 169,957 179,942,209 16 01/94 154,626 165,017,628 15 10/93 131,649 147,224,690 14 07/93 120,350 138,686,333 JPO inclusion started 13 04/93 112,067 129,784,445 12 01/93 97,683 120,815,244 EST division started 11 07/92 65,693 84,839,075 10 01/92 59,317 77,805,556 GenBank/EMBL inclusion started 9 07/91 1,130 2,002,124 8 01/91 879 1,573,442 7 07/90 681 1,154,211 6 01/90 496 841,236 5 07/89 395 679,378 4 01/89 302 535,985 3 07/88 230 345,850 2 01/88 142 199,392 1 07/87 66 108,970 Started with DDBJ only ------------------ Since release 79 ------------------ A new line, DBLINK, has replaced PROJECT line: Following the agreement at the INSD collaborative meeting in 2008, the scope of the project ID has expanded to include projects that are not necessarily targeted to the sequencing of a complete genome. In addition, there are other resources such as the Trace Assembly Archive at the NCBI and the like. Therefore, we have decided to replace the PROJECT line by a new line format, "DBLINK". The replacement is illustrated in the following; From the use of the PROJECT line (-release 78); ------------------------------------------------------------------------------- LOCUS AP000000 4700000 bp DNA circular BCT 27-FEB-2009 DEFINITION Escherichia coli DDBJ genomic DNA, complete genome. ACCESSION AP000000 VERSION AP000000.1 PROJECT GenomeProject:99999 KEYWORDS . ------------------------------------------------------------------------------- To the DBLINK line format (release 79-); ------------------------------------------------------------------------------- LOCUS AP000000 4700000 bp DNA circular BCT 27-FEB-2009 DEFINITION Escherichia coli DDBJ genomic DNA, complete genome. ACCESSION AP000000 VERSION AP000000.1 DBLINK Project:99999 KEYWORDS . ------------------------------------------------------------------------------- ------------------ Since release 75 ------------------ A new division for assembled mRNA sequences, Transcriptome Shotgun Assembly (TSA), has been included since the release 75. With new sequencing technologies in use, INSDC have faced many requests to accept assembled EST sequences. These sequence data have become more useful than used to be, although they may not be correctly assembled or exist in nature. Therefore, INSDC decided to collect assembled EST sequences and classified them into the new division 'TSA'. TSA sequences are shotgun assemblies of primary sequences deposited in the EST division of INSDC, race Archive (TA) or Short-Read Archive (SRA). Two specific keywords, "TSA" and "Transcriptome Shotgun Assembly", are present in all TSA entries. The new division code, "TSA", is also described in the the LOCUS line in all TSA entries. No format changes in the flat file are anticipated for the TSA division, however, note that TSA entries make use of the same PRIMARY line that is described for the entries in TPA category (See also '3.2. TPA separated from primary dataset'). The PRIMARY block contains references to the underlying reads/transcripts that are assembled to construct a TSA record. Note that it is required for a TSA submission to submit sequence data of primary transcripts to the EST division of INSDC, TA, or SRA. More information about how to submit a TSA entry is provided via the following URL; http://www.ddbj.nig.ac.jp/sub/tsa-e.html ------------------ Since release 73 ------------------ Introduction of the sequence data from the Korean Intellectual Property Office: The nucleotide sequence data transferred from Korean Intellectual Property Office (KIPO) have been included in DDBJ release. See also, '3.1. Division categories' and '3.3. Notice for patent related sequence data'. ------------------ Since release 72 ------------------ Deletion of E-mail address, phone and fax numbers from DDBJ flat file: To follow the Japanese law of protecting personal information, DDBJ deleted both phone and fax numbers, and E-mail address from the flat files of the entries submitted to DDBJ. It would be also helpful to protect DDBJ releases against SPAM mail senders. DDBJ retrofitted most of all entries submitted to DDBJ, not to GenBank or EMBL-Bank, by the DDBJ periodical release 72. Previously, the submitter information was described in JOURNAL line at REFERENCE 1 as, -------------------------------------------------------------------------------- REFERENCE 1 (bases 1 to 1200) AUTHORS Mishima,T. TITLE Direct Submission JOURNAL Submitted (01-Jan-1990) to the DDBJ/EMBL/GenBank databases. Taro Mishima, DNA Data Bank of Japan, National Institute of Genetics; 1111, Yata, Mishima, Shizuoka 411-8540, Japan (E-mail:ddbj@ddbj.nig.ac.jp, URL:http://www.ddbj.nig.ac.jp/, Tel:81-12-345-6789, Fax:81-12-345-9876) -------------------------------------------------------------------------------- After the deletion or the information in question, DDBJ flat file is either one of the following two types; Type 1: Phone and fax numbers and E-mail address are deleted. -------------------------------------------------------------------------------- REFERENCE 1 (bases 1 to 1200) AUTHORS Mishima,T. TITLE Direct Submission JOURNAL Submitted (01-Jan-1990) to the DDBJ/EMBL/GenBank databases. Contact:Taro Mishima DNA Data Bank of Japan, National Institute of Genetics; 1111, Yata, Mishima, Shizuoka 411-8540, Japan URL :http://www.ddbj.nig.ac.jp/ ------------------------------------------------------------------------------- Type 2: When the submitters wish to keep their contact information disclosed, it is described as, ------------------------------------------------------------------------------- REFERENCE 1 (bases 1 to 1200) AUTHORS Mishima,T. TITLE Direct Submission JOURNAL Submitted (01-Jan-1990) to the DDBJ/EMBL/GenBank databases. Contact:Taro Mishima DNA Data Bank of Japan, National Institute of Genetics; 1111, Yata, Mishima, Shizuoka 411-8540, Japan URL :http://www.ddbj.nig.ac.jp/ E-mail :ddbj@ddbj.nig.ac.jp Phone :81-12-345-6789 Fax :81-12-345-9876 ------------------------------------------------------------------------------- ------------------ Since release 69 ------------------ Introduction of the project ID at PROJECT line in DDBJ flat file: Following the agreement at the INSD collaborative meeting in 2006, INSDC has started to assign the project ID for submissions from sequencing projects. The description of project ID is shown as below; ---------------------------------------------------------------------------- A unique identifier, assigned at the time of the submission by a sequencing project that informed INSDC of the submission beforehand. It is recommended that the submitter quotes the assigned project ID in all communication with INSDC databases to allow for easier and faster tracking of issues. The project ID field provides an umbrella identifier that points to all related sequence data for the project. ---------------------------------------------------------------------------- The PROJECT lines contain INSDC-assigned ID for the sequencing project. It will be appeared between VERSION and KEYWORDS lines in DDBJ flat files, from the DDBJ periodical release, 69 as shown below. See also '2. DDBJ flat file format'. ---------------------------------------------------------------------------- ACCESSION AB012345 VERSION AB012345.1 PROJECT GenomeProject:123 KEYWORDS . ---------------------------------------------------------------------------- Termination of providing the index files for each category: For users logging in one of our computers (supernig), we provided index files for each category. However, as the computer system in our institute was replaced with a new one which does not have a service using the index files, we terminated providing the index files. ------------------ Since release 68 ------------------ Split of files: We changed the maximum file size from 300 MB to 1.5 GB, because the network capacity has been remarkably increased. Each file named as ddbj***##.seq has at most 1.5 GB storage capacity. See also the sections, '6. File categories' and '9. File list'. ------------------ Since release 64 ------------------ Split of index files: In the present release, some of index files (ddbjacc.idx, ddbjjou.idx, and ddbjkey.idx) have been greater than 2 GB in the file size. So, these have been recorded in multiple ddbj****.idx files, each of which at most has 1.5 GB storage capacity as follows, respectively. See also 6., 7.2., 7.3., 7.4. and 9. ------------------ Since release 62 ------------------ Release version number is introduced: DDBJ has started to include the item, 'version', for its release note, which indicates a version for its periodical release. It is expressed like '62.0', in which the digit(s) after the period is a version number. The reason for adding the version number is that a released data is sometimes revised due to urgent and necessary corrections. The number is increased by one every time when a revised periodical release is made public until the next release. Introduction of ENV division: Recently, the submissions of the sequences derived from environmental samples have rapidly increased. To accommodate such submissions, a new division, ENV, has been created (See also '3.1. Division categories'). This division contains the sequences obtained via direct molecular isolation such as PCR, DGGE, or any anonymous method. In the past, the sequences derived from environmental samples belonged to taxonomic divisions, mainly BCT. At DDBJ, the retrofit to transfer relevant entries from taxonomic divisions to the ENV division starts in the present release, and ends by the next periodical release. Please note that during this transitional period, some entries to be eventually placed in the ENV division will be found in other divisions. Strand information is removed: The strand information of LOCUS line in the flat file has been removed as shown below. See also '2.1. LOCUS line'. ---------------------------------------------------------------------------- Old (-rel. 61): 44-44 space 45-47 spaces, ss- (single-stranded), ds- (double-stranded), or ms- (mixed-stranded) New (rel. 62-): 44-47 spaces ---------------------------------------------------------------------------- ------------------ Since release 61 ------------------ The style of release note (this file) has been changed. Some entries have the sequential format for the secondary accession numbers in the ACCESSION line, in order to make the expression of secondary accession numbers in the past short. For example; ------------------------------------------------------------------------------ Before; ACCESSION AB000802 D85885 D85886 D85887 After; ACCESSION AB000802 D85885-D85887 ------------------------------------------------------------------------------ See also '2.3. ACCESSION line'. ------------------ Since release 60 ------------------ The cross-reference to the H-invitational has been included. ------------------ Since release 56 ------------------ The three data banks have agreed that the maximum length limitation (350 kb) of a submitted sequence be relaxed. The BASE COUNT line of the DDBJ flat file format has been changed, corresponding to the relaxation of the maximum sequence length restriction in the entry that had been practiced at DDBJ/EMBL/GenBank International Nucleotide Sequence Databases. In the BASE COUNT line of the DDBJ flat file, 6 digits had been allocated for each number of a, c, g, t and other bases in the sequence. Hereafter, in the new flat file format, 9 digits are allocated for each number of a, c, g and t, while the numbers of other bases are removed. In accordance with the relaxation of sequence length limitation, GenBank had already dropped the BASE COUNT line from their flat file format from GenBank Release 138 (Oct. 2003). We DDBJ have decided to maintain the BASE COUNT line in our flat file format from the view that GC contents are still important information to characterize the sequence. The changes in the BASE COUNT line are shown below. ---------------------------------------------------------------------------- Old (-rel. 55): 1 6 11 16 21 26 31 36 41 46 51 56 61 66 71 |----|----|----|----|----|----|----|----|----|----|----|----|----|----| BASE COUNT 123456 a 123456 c 123456 g 123456 t 123456 others New (rel. 56-): 1 6 11 16 21 26 31 36 41 46 51 56 61 66 71 |----|----|----|----|----|----|----|----|----|----|----|----|----|----| BASE COUNT 123456789 a 123456789 c 123456789 g 123456789 t ---------------------------------------------------------------------------- ------------------ Since release 54 ------------------ '/sequenced_mol' qualifier has been changed to '/mol_type' qualifier. We accordingly completed retrofitting the pertinent entries. This change was made on the agreement at the INSD collaborative meeting in 2002. ------------------ Since release 51 ------------------ The TPA (Third Party Annotation) dataset has been available. The dataset is a complement to the existing DDBJ/EMBL/GenBank database of the primary nucleotide sequences which were obtained from direct sequencing of cDNAs, ESTs, genomic DNAs etc. The format of LOCUS line in the flat file has been changed as shown below to adjust to the GenBank format. ------------------------------------------------------------------------------ Old (-rel. 50): LOCUS AB000001 660 bp DNA PLN 01-FEB-2001 New (rel. 51-): LOCUS AB000001 660 bp DNA linear PLN 01-FEB-2001 ------------------------------------------------------------------------------ ------------------ Since release 45 ------------------ The HTC (High Throughput cDNA) division has been included. This is to include unfinished high throughput cDNA sequences, each of which has 5'UTR and 3'UTR at both ends and part of a coding region. The sequence may also include introns. When the sequence becomes finished later, it moves to the corresponding taxonomic division. The sequence is accompanied with a keyword, HTC (High Throughput cDNA), which is dropped when the sequence is finished and moved to a taxonomic division. ------------------ Since release 41 ------------------ The CON division has been included. This division is to show the order of related sequences in a genome, and expressed by join and the accession numbers of the sequences. The contents of the CON division are compiled by the three data banks not by the data submitter. ------------------ Since release 40 ------------------ The RNA division was terminated. The RNA data have been redistributed according to the category of the organism. Therefore, you will find a human RNA sequence, for example, in the HUM division. ------------------ Since release 37 ------------------ The three data banks include the item VERSION in the flat file, which indicates a version of a submitted nucleotide sequence. It is expressed like AB123456.1, in which the digit(s) after the period is a version number. The reason for adding VERSION is that since a released sequence sometimes revised by the submitter, the accession number alone cannot specify the sequence in question causing the user a trouble. The number is increased by one every time when a revised sequence is made public. Accordingly, the translated protein sequence will be accompanied with a /protein_id which is expressed as BAA12345.1, in which the digit(s) after the period is again a version number. The number is increased by one when the corresponding nucleotide sequence is revised and the protein sequence is changed as a result, and when the revised protein sequence is made public. ------------------ Since release 31 ------------------ We have started adopting the unified taxonomy database to unify the biological source of the sequence. The database is made up with scientific names, ID of unidentified organisms, and synthetic constructs etc. ------------------ Since release 30 ------------------ NID and PID were terminated. This change was made on the agreement at the INSD collaborative meeting in 1999. ------------------ Since release 28 ------------------ The HTG (High Throughput Genomic sequence) has been included. This division was created to cope with genome project teams which deal with a clone as a sequencing unit. We terminated the ORG (Organelle) division. Thus, if you are interested in human mitochondrial sequences, for example, you are now advised to refer to the HUM division. ------------------ Since release 27 ------------------ The GSS division has been included. GSS stands for Genome Survey Sequence, which is similar to EST, except that GSS is genomic DNA whereas EST is cDNA. ------------------ Since release 25 ------------------ DDBJ release contains amino acid sequences that were translated from the corresponding nucleotide sequences of the database. In the translation we paid much attention to the fact that some species or organella have a codon different from the universal one, and used the proper codon table. ------------------ Since release 22 ------------------ The HUM division has been included. Human genome projects have probably been most productive and yielded a large number of sequences Thus, we have the human (HUM) division solely for human sequences and the primate (PRI) division for non-human primate sequences. ------------------ Since release 12 ------------------ The EST (Expressed Sequence Tag) division has been included. The number of ESTs has been increasing at an enormous rate and is expected to be growing even more rapidly in the future. Thus, we created a division for ESTs ------------------ Since release 10 ------------------ The sequences submitted to GenBank or EMBL have been included in the release. 9. File list The files in this release are arranged in the following order with non-labeled format. ----------------------------------------------------------------------- file name file size ----------------------------------------------------------------------- ddbjrel.txt (DDBJ release note) 75000 ddbjacc1.idx (Accession number index file 1) 1499999996 ddbjacc2.idx (Accession number index file 2) 1500000031 ddbjacc3.idx (Accession number index file 3) 1381944772 ddbjgen.idx (Gene name index file) 163710327 ddbjjou1.idx (Journal citation index file 1) 1499999831 ddbjjou2.idx (Journal citation index file 2) 1454122803 ddbjjou3.idx (Journal citation index file 3) 1418735566 ddbjjou4.idx (Journal citation index file 4) 258874324 ddbjkey1.idx (Keyword phrase index file 1) 1499999963 ddbjkey2.idx (Keyword phrase index file 2) 1499999934 ddbjkey3.idx (Keyword phrase index file 3) 1413211823 ----------------------------------------------------------------------- file name number of entries number of bases file size ----------------------------------------------------------------------- ddbjbct1.seq 129209 613638874 1499348792 ddbjbct2.seq 92698 652132311 1509656780 ddbjbct3.seq 420 676241706 1504463697 ddbjbct4.seq 341 661552144 1499093696 ddbjbct5.seq 435 663102613 1500396322 ddbjbct6.seq 709 653709773 1506705469 ddbjbct7.seq 306911 496269834 1426879484 ddbjenv1.seq 576831 403389390 1499001179 ddbjenv2.seq 556093 417732687 1499000823 ddbjenv3.seq 565941 394191636 1499000077 ddbjenv4.seq 170094 64371100 352881974 ddbjest1.seq 461404 172637580 1499002915 ddbjest2.seq 489028 191392155 1499000466 ddbjest3.seq 496920 205467042 1499000920 ddbjest4.seq 478884 204162986 1498999949 ddbjest5.seq 546754 291205940 1499002329 ddbjest6.seq 551454 337215376 1499001096 ddbjest7.seq 538635 306812523 1499000074 ddbjest8.seq 400326 128158087 1499002885 ddbjest9.seq 489111 209783226 1499001480 ddbjest10.seq 510492 236251653 1499002355 ddbjest11.seq 468827 200490760 1499002619 ddbjest12.seq 370249 131547538 1499000062 ddbjest13.seq 274520 83762061 1499002191 ddbjest14.seq 274923 108605048 1499002676 ddbjest15.seq 382328 177870132 1499000514 ddbjest16.seq 479011 247892799 1499001775 ddbjest17.seq 462383 242653503 1499002390 ddbjest18.seq 451373 248304279 1499002875 ddbjest19.seq 462263 221825009 1499002328 ddbjest20.seq 462463 279232331 1499002415 ddbjest21.seq 468086 286559524 1499001653 ddbjest22.seq 467151 243886628 1499001853 ddbjest23.seq 446563 262673638 1499002463 ddbjest24.seq 503584 277432447 1499001917 ddbjest25.seq 547861 319817725 1499000018 ddbjest26.seq 416846 210553350 1499004614 ddbjest27.seq 432324 254397545 1499004312 ddbjest28.seq 477395 270470220 1499002909 ddbjest29.seq 515302 263384582 1499001478 ddbjest30.seq 452799 242537461 1499001631 ddbjest31.seq 453703 252183270 1499002281 ddbjest32.seq 443568 287884104 1499001866 ddbjest33.seq 409721 292959220 1499000681 ddbjest34.seq 493725 294026400 1499000537 ddbjest35.seq 642292 369730350 1499001184 ddbjest36.seq 471898 299473787 1499002834 ddbjest37.seq 419548 248027878 1499002905 ddbjest38.seq 258434 97094937 1499005072 ddbjest39.seq 259183 104673524 1499002426 ddbjest40.seq 311729 149337517 1499000073 ddbjest41.seq 481658 272673941 1499000927 ddbjest42.seq 480385 266516041 1499001053 ddbjest43.seq 447811 239670072 1499001814 ddbjest44.seq 476863 281211438 1499001852 ddbjest45.seq 512028 258106319 1499001576 ddbjest46.seq 432339 256005292 1499001145 ddbjest47.seq 554728 284750760 1499002345 ddbjest48.seq 428077 243981202 1499003519 ddbjest49.seq 400570 234629213 1499002648 ddbjest50.seq 262884 133947127 1499002674 ddbjest51.seq 267929 109298176 1499001521 ddbjest52.seq 309827 137084057 1499000950 ddbjest53.seq 415953 231398699 1499001731 ddbjest54.seq 557331 317128704 1499000710 ddbjest55.seq 425608 285769731 1499002185 ddbjest56.seq 442664 243880762 1499004219 ddbjest57.seq 474751 279955587 1499002850 ddbjest58.seq 427838 233439127 1499000973 ddbjest59.seq 481013 269844807 1499003044 ddbjest60.seq 447471 274791409 1499000006 ddbjest61.seq 421060 241211479 1499003178 ddbjest62.seq 491602 333612285 1499002109 ddbjest63.seq 447195 274073621 1499000763 ddbjest64.seq 446588 223983272 1499001024 ddbjest65.seq 433523 267891753 1499001269 ddbjest66.seq 434411 280891233 1499001886 ddbjest67.seq 394656 255699918 1499001682 ddbjest68.seq 429679 239367934 1499002079 ddbjest69.seq 425061 236637032 1499003467 ddbjest70.seq 428103 237481211 1499000758 ddbjest71.seq 427786 226516744 1499000673 ddbjest72.seq 513041 298303550 1499001390 ddbjest73.seq 536955 329744498 1499002254 ddbjest74.seq 584333 334571089 1499001759 ddbjest75.seq 448201 280398580 1499000944 ddbjest76.seq 434359 317888954 1499001102 ddbjest77.seq 446580 282431747 1499000647 ddbjest78.seq 467686 291941605 1499003346 ddbjest79.seq 385832 260983985 1499001006 ddbjest80.seq 381209 272885182 1499002440 ddbjest81.seq 403044 277363025 1499001881 ddbjest82.seq 408248 309911176 1499001691 ddbjest83.seq 481764 299845788 1499002468 ddbjest84.seq 436669 317999917 1499001930 ddbjest85.seq 523370 300536593 1499000670 ddbjest86.seq 587250 199377016 1499000340 ddbjest87.seq 500442 311561648 1499002784 ddbjest88.seq 499150 314020304 1499000594 ddbjest89.seq 510460 310276158 1499000763 ddbjest90.seq 660770 302531345 1499002476 ddbjest91.seq 567713 267364474 1499001332 ddbjest92.seq 509626 314080577 1499002310 ddbjest93.seq 504264 279014868 1499001369 ddbjest94.seq 547023 208454257 1499002396 ddbjest95.seq 512732 319174329 1499002295 ddbjest96.seq 416100 236794894 1499001819 ddbjest97.seq 605258 181015265 1499000745 ddbjest98.seq 510085 267085177 1499000617 ddbjest99.seq 565916 210110336 1499000532 ddbjest100.seq 478394 287633671 1499000303 ddbjest101.seq 494765 331331158 1499001279 ddbjest102.seq 510056 300353813 1499002087 ddbjest103.seq 585271 221618333 1499000711 ddbjest104.seq 548024 284031484 1499001664 ddbjest105.seq 423945 268892276 1499000639 ddbjest106.seq 461327 281845613 1499001076 ddbjest107.seq 448137 285259570 1499001886 ddbjest108.seq 465543 337124785 1499002095 ddbjest109.seq 445889 301519732 1499000963 ddbjest110.seq 406158 275837115 1499002273 ddbjest111.seq 450233 292798608 1499000930 ddbjest112.seq 448150 285113756 1499002798 ddbjest113.seq 430618 268035093 1499002248 ddbjest114.seq 443090 248547074 1499001744 ddbjest115.seq 377118 240357665 1499001931 ddbjest116.seq 535477 252177529 1499001099 ddbjest117.seq 444955 274454223 1499002117 ddbjest118.seq 451789 290227258 1499001922 ddbjest119.seq 488577 305122767 1499001821 ddbjest120.seq 301056 178362547 1499002729 ddbjest121.seq 418714 157979994 1499001788 ddbjest122.seq 529704 241408720 1498999966 ddbjest123.seq 603823 309253393 1499000067 ddbjest124.seq 428162 264913874 1499002199 ddbjest125.seq 557125 259846517 1499000313 ddbjest126.seq 524346 281644770 1499002428 ddbjest127.seq 501048 163282677 1499001720 ddbjest128.seq 450320 76907330 1499002599 ddbjest129.seq 469195 227374149 1499000544 ddbjest130.seq 465235 306792744 1499002700 ddbjest131.seq 433984 295648956 1499001997 ddbjest132.seq 467550 233493165 1499000536 ddbjest133.seq 461099 251746195 1499001903 ddbjest134.seq 490313 303285397 1499000406 ddbjest135.seq 409115 269880556 1499000731 ddbjest136.seq 457076 268573061 1499001470 ddbjest137.seq 409620 260018066 1499006282 ddbjest138.seq 330697 178728887 1499000501 ddbjest139.seq 344225 126146468 1088163214 ddbjgss1.seq 478720 345736293 1498999982 ddbjgss2.seq 446202 341981188 1499002065 ddbjgss3.seq 441849 334127565 1499001409 ddbjgss4.seq 563976 272512682 1499002041 ddbjgss5.seq 485446 252775708 1499001419 ddbjgss6.seq 465218 255357356 1499000135 ddbjgss7.seq 390524 193635244 1499000196 ddbjgss8.seq 413528 207709650 1499002022 ddbjgss9.seq 495820 286403440 1499001872 ddbjgss10.seq 553297 308811739 1499000520 ddbjgss11.seq 496018 296305677 1499000429 ddbjgss12.seq 538845 351887502 1499000695 ddbjgss13.seq 514077 354489573 1499001513 ddbjgss14.seq 514040 357852488 1499001317 ddbjgss15.seq 601982 341847636 1499000136 ddbjgss16.seq 608571 364013777 1499001973 ddbjgss17.seq 564906 322446219 1499000063 ddbjgss18.seq 522127 373026712 1499001479 ddbjgss19.seq 511557 339572142 1499001410 ddbjgss20.seq 572413 369213573 1499000370 ddbjgss21.seq 580207 408088681 1499001977 ddbjgss22.seq 545069 331671819 1499003476 ddbjgss23.seq 472749 279843200 1499002156 ddbjgss24.seq 513771 326557684 1499002676 ddbjgss25.seq 535297 357134427 1499000258 ddbjgss26.seq 531008 341108576 1499001342 ddbjgss27.seq 585234 299547302 1499001123 ddbjgss28.seq 575068 278559672 1499001055 ddbjgss29.seq 548317 346699256 1499002254 ddbjgss30.seq 473299 340856099 1499001686 ddbjgss31.seq 484654 378581237 1499001560 ddbjgss32.seq 552162 342544711 1499000694 ddbjgss33.seq 544962 331090945 1499000408 ddbjgss34.seq 468538 358200413 1499002489 ddbjgss35.seq 544053 318329545 1499001062 ddbjgss36.seq 516256 275561391 1499000758 ddbjgss37.seq 553203 289423824 1499002599 ddbjgss38.seq 391830 315140786 1499000527 ddbjgss39.seq 413248 339433287 1499001646 ddbjgss40.seq 426374 344074270 1499000066 ddbjgss41.seq 414645 338703029 1499002658 ddbjgss42.seq 424080 344716913 1499001049 ddbjgss43.seq 420431 340692606 1499001016 ddbjgss44.seq 429490 345699346 1499000632 ddbjgss45.seq 525238 325917340 1499001841 ddbjgss46.seq 582733 369763942 1499000911 ddbjgss47.seq 593037 405848075 1499000260 ddbjgss48.seq 579095 421251944 1499002185 ddbjgss49.seq 448441 246795133 1499000771 ddbjgss50.seq 520064 344140024 1499002312 ddbjgss51.seq 522106 391987025 1499000098 ddbjgss52.seq 518836 415834903 1499002058 ddbjgss53.seq 539144 364771048 1499002485 ddbjgss54.seq 195566 120905205 539805263 ddbjhtc1.seq 275123 360774310 1499000265 ddbjhtc2.seq 276231 277639262 987667416 ddbjhtg1.seq 11401 1118106723 1499008476 ddbjhtg2.seq 7562 1118206224 1499000303 ddbjhtg3.seq 5909 1130568515 1499078479 ddbjhtg4.seq 5460 1140430800 1499337500 ddbjhtg5.seq 5333 1144058630 1499095416 ddbjhtg6.seq 5356 1144161975 1499207460 ddbjhtg7.seq 6578 1132361542 1499177428 ddbjhtg8.seq 6856 1143130880 1499127577 ddbjhtg9.seq 6263 1139357283 1499006185 ddbjhtg10.seq 6324 1133166929 1499088723 ddbjhtg11.seq 7038 1123549489 1499014023 ddbjhtg12.seq 7001 1125082547 1499014075 ddbjhtg13.seq 6951 1141441040 1499029226 ddbjhtg14.seq 6972 1135065149 1499048608 ddbjhtg15.seq 6773 1141428421 1499206964 ddbjhtg16.seq 6350 1139131623 1499063961 ddbjhtg17.seq 6595 1139284036 1499248367 ddbjhtg18.seq 8370 1145868803 1499026200 ddbjhtg19.seq 6034 1135505551 1499182889 ddbjhtg20.seq 6650 1158954688 1499034066 ddbjhtg21.seq 6725 1158900026 1499090793 ddbjhtg22.seq 1206 182110542 236617007 ddbjhum1.seq 28858 1048594958 1499026986 ddbjhum2.seq 8106 1069520945 1499078907 ddbjhum3.seq 146156 823329575 1499051539 ddbjhum4.seq 21614 1075074539 1499090481 ddbjhum5.seq 257552 552590554 1499002309 ddbjhum6.seq 27043 54114569 123876674 ddbjinv1.seq 236355 704880888 1500609987 ddbjinv2.seq 439035 440400289 1499000606 ddbjinv3.seq 231872 661371806 1489009647 ddbjmam.seq 217485 601162981 1242048654 ddbjpat1.seq 1034560 519799563 1499001462 ddbjpat2.seq 776082 493372155 1498999999 ddbjpat3.seq 739411 347619438 1499000375 ddbjpat4.seq 702648 595130668 1499019033 ddbjpat5.seq 733075 398324077 1499000664 ddbjpat6.seq 741114 330134244 1499002416 ddbjpat7.seq 689653 384960021 1499030184 ddbjpat8.seq 795953 529837449 1499000276 ddbjpat9.seq 901072 524578374 1499000971 ddbjpat10.seq 853831 591002271 1499001188 ddbjpat11.seq 1062924 349490134 1499024689 ddbjpat12.seq 907316 553044343 1499002777 ddbjpat13.seq 1289574 204174591 1498999966 ddbjpat14.seq 427788 348052322 983718601 ddbjphg.seq 5197 39126337 96086137 ddbjpln1.seq 120435 917898994 1499005548 ddbjpln2.seq 242742 561459365 1499015264 ddbjpln3.seq 82583 903114238 1499001046 ddbjpln4.seq 290645 588781520 1499008603 ddbjpln5.seq 469117 429720764 1499001873 ddbjpln6.seq 397593 386597718 1288554313 ddbjpri1.seq 49336 1078473653 1499071017 ddbjpri2.seq 28263 91490437 177043642 ddbjrod1.seq 35308 1018082649 1499205003 ddbjrod2.seq 5883 1092198781 1499173413 ddbjrod3.seq 41060 1053684471 1499152008 ddbjrod4.seq 78001 892261371 1499142198 ddbjrod5.seq 209340 161549754 564136519 ddbjsts1.seq 416891 210378788 1499003729 ddbjsts2.seq 338718 238537638 1499000438 ddbjsts3.seq 555160 180702534 1464739613 ddbjsyn.seq 90452 136220312 484363192 ddbjtsa.seq 149952 49551403 308743455 ddbjuna.seq 290 486282 1376896 ddbjvrl1.seq 396651 403471290 1499002176 ddbjvrl2.seq 366497 424080440 1499154411 ddbjvrl3.seq 8179 7830515 28673227 ddbjvrt1.seq 242907 676346554 1499002257 ddbjvrt2.seq 61994 1019056563 1499001540 ddbjvrt3.seq 290725 684517330 1499000770 ddbjvrt4.seq 40735 29826512 119257689 ------------------------------------------------------------------------------ Total 112314250 109636862252 401275591695 ddbjtpa.seq 55263 56513248 243397881 ddbjcon1.seq 257953 0 1499004559 ddbjcon2.seq 254669 0 1499000281 ddbjcon3.seq 539097 0 1499001017 ddbjcon4.seq 400768 0 1499002027 ddbjcon5.seq 341434 0 1499008632 ddbjcon6.seq 267241 0 1499009598 ddbjcon7.seq 451916 0 1499001994 ddbjcon8.seq 298033 0 1499079031 ddbjcon9.seq 238473 0 1500896037 ddbjcon10.seq 228272 0 1499002762 ddbjcon11.seq 242281 0 1499000662 ddbjcon12.seq 267602 0 1499002823 ddbjcon13.seq 289371 0 1499001028 ddbjcon14.seq 317181 0 1499005138 ddbjcon15.seq 275959 0 1499003652 ddbjcon16.seq 276545 0 1499000094 ddbjcon17.seq 285254 0 1499001420 ddbjcon18.seq 266917 0 1499004394 ddbjcon19.seq 265757 0 1499001068 ddbjcon20.seq 100619 0 256569521 The entries and bases in the CON division and TPA dataset are not counted in the numbers given on the top of the release note or 'Total' on the above table.