DNA Data Bank of Japan DNA Database Release 83.0, Sep. 2010, including 124,079,491 entries, 117,728,717,442 bases Last published date in the present release: August 27, 2010 ------------------------------------------------------------------------------- Table of contents ------------------------------------------------------------------------------- 1. Introduction 1.1. Announcement for changes in the present release 1.2. Announcement for the forthcoming changes 2. DDBJ flat file format 2.1. LOCUS line 2.2. DEFINITION line 2.3. ACCESSION line 2.4. VERSION line 2.5. KEYWORDS line 2.6. SOURCE line 2.7. REFERENCE line 2.8. COMMENT line 2.9. FEATURES line 2.10. BASE COUNT line 2.11. ORIGIN line 3. Division categories 3.1. Notice for patent related sequence data 4. DDBJ staff 5. Acknowledgment 6. File categories 7. Sample of the contents in each file 7.1. Part of the contents in the file 'ddbjbct1.seq' 7.2. Part of the contents in the accession number index file 'ddbjacc1.idx' 7.3. Part of the contents in the keyword phrase index file 'ddbjkey1.idx' 7.4. Part of the contents in the journal citation index file 'ddbjjou1.idx' 7.5. Part of the contents in the gene name index 'ddbjgen.idx' 8. Release history 9. File list ------------------------------------------------------------------------------- 1. Introduction The present release contains the newest data prepared by the DNA Data Bank of Japan (DDBJ), GenBank (*), and EMBL-Bank/European Bioinformatics Institute (EMBL-Bank/EBI) as of August 27, 2010. This unified database was made possible thanks to the international collaboration among the three data banks. All the entries have accordingly been annotated using the feature keys common to them. In 2005, DDBJ, EMBL-Bank and GenBank agreed to call their collaboration "the International Nucleotide Sequence Database Collaboration (INSDC); http://www.insdc.org " and to call the unified nucleotide sequence database "the International Nucleotide Sequence Database (INSD)". *'GenBank' is a trademark of NIH, USA, and is operated by National Center for Biotechnology Information (NCBI) at NIH. This database may be copied and redistributed without permission on the condition that all the statements in this release note are reproduced in each copy. See also '3.1. Notice for patent related sequence data' below. 1.1. Announcement for changes in the present release Nothing particular. 1.2. Announcement for the forthcoming changes Revision of the DDBJ/EMBL/GenBank Feature Table: Definition: Following the agreement at the INSD collaborative meeting in 2010, the document, DDBJ/EMBL/GenBank Feature Table: Definition, will be revised. See also '2.9. FEATURES line' below. The revised points are introduced in advance on the following URL; http://www.ddbj.nig.ac.jp/insdc/icm2010-e.html#ft At DDBJ, the retrofit for this revision will be completed by the next periodical release to be published in December 2010. Please note that during this transitional period, some entries will be retrofitted. 2. DDBJ flat file format The database is a collection of "entry" which is the unit of the data. The entries submitted to databanks were processed and publicized according to the DDBJ format for distribution (flat file). The flat file includes the sequence and the information of submitters, references, source organisms, and "feature" information, etc. The items of the DDBJ flat file are explained at following; ------------------------------------------------------------------------------- LOCUS AB000000 450 bp mRNA linear HUM 08-JUL-2002 DEFINITION Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds. ACCESSION AB000000 VERSION AB000000.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 450) AUTHORS Mishima,H. and Shizuoka,T. TITLE Direct Submission JOURNAL Submitted (30-NOV-2000) to the DDBJ/EMBL/GenBank databases. Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; 1111, Yata, Mishima, Shizuoka 411-8540, Japan REFERENCE 2 AUTHORS Mishima,H., Shizuoka,T. and Fuji,I. TITLE Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver JOURNAL Unpublished (2002) COMMENT Human cDNA sequencing project. FEATURES Location/Qualifiers source 1..450 /chromosome="12" /clone="GT200015" /clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)" /map="12p13" /mol_type="mRNA" /organism="Homo sapiens" /tissue_type="liver" CDS 86..>450 /codon_start=1 /gene="GAPD" /product="glyceraldehyde-3-phosphate dehydrogenase" /protein_id="BAA12345.1" /transl_table=1 /translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV" BASE COUNT 102 a 119 c 131 g 98 t ORIGIN 1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct 61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg 121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc 181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt 241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg 301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac 361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc 421 tcaacttaag ggtggtgcta agaaggtctg // ------------------------------------------------------------------------------- 2.1. LOCUS line The format of LOCUS line in the flat file is shown below; --------- -------- Positions Contents --------- -------- 01-05 'LOCUS' 06-12 spaces 13-28 Locus name 29-29 space 30-40 Length of sequence, right-justified 41-41 space 42-43 'bp' 44-47 spaces 48-54 DNA, RNA, mRNA, rRNA, tRNA or cRNA, left justified 55-55 space 56-63 'linear' followed by two spaces, or 'circular' 64-64 space 65-67 The division code (see '3.1. Division categories') 68-68 space 69-79 Date, in the form dd-MMM-yyyy (e.g., 08-JUL-2002) ------------------------------------------------------------------------------ 2.2. DEFINITION line The definition briefly describes the information of gene(s). "DEFINITION" is constructed by each of the three data banks. 2.3. ACCESSION line This line shows accession number of the entry data. A unique accession number is issued to the data submitter by each of the three data banks. The accession number is composed of 1 alphabet character and 5 digits (ex. A12345) or 2 alphabet characters and 6 digits (ex. AB123456). The former style was used in 1980s, but later the latter style was introduced because of data explosion. All the entries designated by the accession numbers with the prefixes given below have been collected and processed by DDBJ, and the rest have been done by GenBank and EMBL-Bank/EBI. ------------------------------------------------------------------------------- C, D, E, AB, AG, AK, AP, AT, AU, AV, BA, BB, BD, BJ, BP, BR, BS, BW, BY, CI, CJ, DA, DB, DC, DD, DE, DF, DG, DH, DI, DJ, DK, DL, DM, FS, FT, FU, FV, FW, FY ------------------------------------------------------------------------------- You can find the list of the prefixes of the accession numbers at the following URL; http://www.ddbj.nig.ac.jp/sub/prefix.html If multiple entries are united to an entry, or if an entry is extensively modified after the submission, the responsible data banks may assign a new accession number to it. In these cases, the new accession number is called the primary accession number, and the old accession number(s) is/are called the secondary accession number(s). In the flat file, the primary accession number is indicated first, then the secondary accession number(s) follows. You can find the same updated entry with both the primary and the secondary accession numbers. 2.4. VERSION line This line consists of an accession number and a version number, like "AB123456.1", in which the digit(s) after the period is a version number. The data open to public for the first time is version number as "1". The reason for adding VERSION is that since a released sequence sometimes revised by the submitter, the accession number alone cannot specify the sequence in question causing the user a trouble. The number is increased by one every time when a revised sequence is made public. 2.5. KEYWORDS line The data banks describe this line, if necessary. In many cases, the categories of the data (EST, HTG etc.), gene names and product names included in "KEYWORDS". 2.6. SOURCE line This line shows the scientific name (and a corresponding common name, if defined as "Genbank common name" in taxonomy database) on organism from which the sequence is obtained and an organelle type if the sequence is derived from an organelle other than the nucleus. 2.7. REFERENCE line The information on the submitters and references related to the submitted sequence is indicated in REFERENCE line. 2.8. COMMENT line. The information about an entry that cannot be described using FEATURES or the other fields. 2.9. FEATURES line Biological features of a submitted sequence data are described with "Feature" key (the biological nature of the annotated feature), "Location" (the region of the sequence which corresponds to Feature), and "Qualifier" (supplementary information about Feature). The "Feature" and "Qualifier" keys used in the present release is defined by DDBJ/EMBL/GenBank Feature Table: Definition Version 8.2 (December, 2009). The document is continuously updated every half year. You can find its newest version on URL; http://www.ddbj.nig.ac.jp/FT/full_index.html 2.10. BASE COUNT line In the BASE COUNT line of the DDBJ flat file, 9 digits are allocated for each number of a (adenine), c (cytosine), g(guanine) and t (thymine). In the case of RNA sequence, uracil is indicated as "t" according to the rule of the international nucleotide database. 2.11. ORIGIN line The sequence data starts from the next line of ORIGIN. The sequence is indicated as lower case letters, delimited by space per 10 bases, starts a new line by 60 bases. The numbers described at left side of lines mean the ordinal number of the top base of the line. 3. Division categories The present release is divided into 21 categories, called 'division', of organisms and others. The contents of the 21 divisions are shown in the following. See also '6. File categories' and '9. File list' below. HUM; human PRI; primates (other than human) ROD; rodents MAM; mammals (other than primates and rodents) VRT; vertebrates (other than mammals) INV; invertebrates (animals other than vertebrates) PLN; plants, fungi, plastids (eukaryotes other than animals) BCT; bacteria (including both Eubacteria and Archaea) VRL; viruses PHG; bacteriophages ENV; sequences obtained via environmental sampling methods SYN; synthetic constructs (artificially constructed sequences) EST; expressed sequence tags; short single pass cDNA sequences GSS; genome survey sequences; short single pass genomic sequences TSA; transcriptome shotgun assemblies HTC; high throughput cDNA sequences; The sequence submitted from cDNA sequencing projects except for EST. This division is to include unfinished high throughput cDNA sequences, each of which has 5'UTR and 3'UTR at both ends and part of a coding region. The sequence may also include introns. When the sequence becomes finished later, it moves to the corresponding taxonomic division. HTG; high throughput genomic sequences The sequence submitted mainly from genome sequencing projects which regarded a clone as a sequencing unit. STS; sequence tagged sites The tag site for genome sequencing. The information of chromosome, map, is mandatory for this division. PAT; sequence data related to patent applications The data those which the Japan Patent Office (JPO), United States Patent and Trademark Office (USPTO), the European Patent Office (EPO), and Korean Intellectual Property Office (KIPO) collected, processed and released. See also '3.3. Notice for patent related sequence data' below. UNA; the data not annotated The UNA division is not used for recently submitted sequences. CON; Contig / Constructed To conjugate a series of entries, such as those submitted from a genome project, each of the three data banks constructs an entry and assign an accession number to a large scale sequence dataset. Such entries are classified into the CON division. The entry in the CON division has the information of joined accession numbers instead of the sequence data. The corresponding entries of the CON entry have been submitted to other divisions. The entries and bases in the CON division are not counted in the released numbers given on the top of the release note. 3.1. Notice for patent related sequence data This release includes PAT division for patent related sequence data as described above. The data those which Japan Patent Office (JPO), United States Patent and Trademark Office (USPTO), European Patent Office (EPO), and Korean Intellectual Property Office (KIPO) collected, processed and released. Sequence data in patent claims to KIPO were properly processed and submitted to DDBJ by Byungwook Lee at Korean Bioinformation Center in collaboration with KIPO. The prefixes of accession numbers for the patent related sequence data are shown below; --------------------------------------------------- JPO : E, BD, DD, DJ, DL, DM, FU, FV, FW KIPO : DI USPTO: I, AR, DZ, EA, GC, GP, GV, GX EPO : A, AX, CQ, CS, FB, GM, GN, HA, HB, HC, HD ---------------------------------------------------- Note also that unauthorized use of the patented data may cause legal issues for which DDBJ takes no responsibility. 4. DDBJ staff This release is published by the following DDBJ staff. Jun Mashima, Hideo Aono, Yoshiyuki Ehara, Mayumi Ejima, Masato Endo, Masahiro Fujimoto, Daisuke Fukuda, Tatsukazu Hashimoto, Fumie Hirata, Nobuhiro Hoshi, Fumiyasu Ishikawa, Kazuya Kanno, Shingo Kawahara, Tatsuko Kawamoto, Takahiro Kazama, Satoshi Kitadate, Wataru Kodachi, Yuichi Kodama, Junko Kohira, Takehide Kosuge, Fumiko Kubodera, Kyungbum Lee, Mika Maki, Haruka Mamiya, Hisako Mashima, Kimiko Mimura, Yoshihisa Munakata, Naoko Murakata, Sachiko Nagira, Masahiko Nagura, Asami Nozaki, Toshihisa Okido, Katsunaga Sakai, Masakazu Sano, Satoshi Saruhashi, Makoto Sato, Yukie Shinyama, Naoki Shiraishi, Rie Sugita, Kouji Suzuki, Kimiko Suzuki, Kazuya Takei, Wataru Tanabe, Haru Tsutsui, Koji Watanabe, Hiroaki Yamada, Kenji Yamamoto, Emi Yokoyama, Takashi Gojobori, Eli Kaminuma, Osamu Ogasawara, Kosaku Okubo, Toshihisa Takagi, Munetaka Takeuchi, and Yasukazu Nakamura Center for Information Biology and DNA Data Bank of Japan National Institute of Genetics Research Organization of Information and Systems Mishima 411-8540, Japan Phone: +81 55 981 6853 FAX: +81 55 981 6849 E-mail: ddbj@ddbj.nig.ac.jp (for general inquiry) ddbjsub@ddbj.nig.ac.jp (for data submission) ddbjupdt@ddbj.nig.ac.jp (for updates and notification of publication) WWW: http://www.ddbj.nig.ac.jp/ (for DDBJ WWW server) http://sakura.ddbj.nig.ac.jp/ (for DDBJ sequence data submission system) 5. Acknowledgment We are grateful to NCBI and EBI for a firm friendship and an excellent collaboration with us. We also thank JPO and KIPO for a steady cooperation with us. The operation of DDBJ is supported by the Ministry of Education, Culture, Sports, Science and Technology, and we would gratefully note this here. DDBJ uses the Super-SINET computer network for data collection, data exchange and various services. 6. File categories This release covers 21 categories (see also '3. Division categories'.) of organisms and others as follows: ------------------------------------------------------------------------------ ddbjbct; Category for bacteria ddbjcon; Category for CON (contigs) ddbjenv; Category for ENV (environmental samples) ddbjest; Category for EST (expressed sequence tags) ddbjgss; Category for GSS (genome survey sequences) ddbjhtc; Category for HTC (high throughput cDNA sequences) ddbjhtg; Category for HTG (high throughput genomic sequences) ddbjhum; Category for human ddbjinv; Category for invertebrates ddbjmam; Category for mammals other than primates and rodents ddbjpat; Category for patents ddbjphg; Category for phages ddbjpln; Category for plants ddbjpri; Category for primates other than human ddbjrod; Category for rodents ddbjsts; Category for STS (sequence tagged sites) ddbjsyn; Category for synthetic DNAs ddbjtsa; Category for TSA (transcriptome shotgun assemblies) ddbjuna; Category for unannotated sequences ddbjvrl; Category for viruses ddbjvrt; Category for vertebrates other than mammals ------------------------------------------------------------------------------ Some of above in the present release are recorded in multiple ddbj***###.seq files, each of which at most has 1.5 GB storage capacity as follows, respectively. --------------------- ddbjbct : 9 files ddbjenv : 5 files ddbjest : 145 files ddbjgss : 56 files ddbjhtc : 2 files ddbjhtg : 22 files ddbjhum : 6 files ddbjinv : 4 files ddbjpat : 20 files ddbjpln : 7 files ddbjpri : 2 files ddbjrod : 5 files ddbjsts : 4 files ddbjtsa : 2 files ddbjvrl : 3 files ddbjvrt : 4 files ddbjcon : 21 files --------------------- The index files included in this release are ddbjacc#.idx, ddbjgen.idx, ddbjjou#.idx, and ddbjkey#.idx. See also '9. File list'. All of them except ddbjgen.idx are recorded in multiple ddbj***#.idx files, each of which at most has 1.5 GB storage capacity. 7. Sample of the contents in each file 7.1. Part of the contents in the file 'ddbjbct1.seq' This shows all pieces of information on one entry in DDBJ format. ------------------------------------------------------------------------------ LOCUS D87069 993 bp mRNA linear BCT 05-OCT-2006 DEFINITION Escherichia coli mRNA for RNA polymerase sigma subunit, truncated form of sigma-38, complete cds. ACCESSION D87069 VERSION D87069.1 KEYWORDS RNA polymerase sigma subunit, truncated form of sigma-38. SOURCE Escherichia coli ORGANISM Escherichia coli Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; Enterobacteriaceae; Escherichia. REFERENCE 1 (bases 1 to 993) AUTHORS Jishage,M. TITLE Direct Submission JOURNAL Submitted (14-AUG-1996) to the DDBJ/EMBL/GenBank databases. Contact:Miki Jishage National Institute of Genetics, Molecular Genetics; Yata 1111, Mishima, Shizuoka 411, Japan REFERENCE 2 AUTHORS Jishage,M. and Ishihama,A. TITLE Variation in RNA polymerase sigma subunit composition within different stocks of Escherichia coli starin W3110 JOURNAL Unpublished (1996) REFERENCE 3 AUTHORS Ivanova,A., Renshaw,M., Guntaka,R. and Eisenstark,A. TITLE DNA base sequence variability in katF (putative sigma factor) gene Escherichia coli JOURNAL Nucleic Acids Res. 20, 5479-5480 (1992) REFERENCE 4 AUTHORS Takayanagi,Y., Tanaka,K. and Takahashi,H. TITLE Structure of the 5' upstream region and the regulation of the rpoS gene of Escherichia coli JOURNAL Mol. Gen. Genet. 243, 525-531 (1994) COMMENT FEATURES Location/Qualifiers source 1..993 /db_xref="taxon:562" /mol_type="mRNA" /organism="Escherichia coli" /strain="W3110" CDS 1..810 /note="the gene has four single base changes, resulting in two amino acid substitutions and an amber mutation" /product="RNA polymerase sigma subunit, truncated form of sigma-38" /protein_id="BAA13238.1" /transl_table=11 /translation="MSQNTLKVHDLNEDAEFDENGVEVFDEKALVEYEPSDNDLAEEE LLSQGATQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLV VKIARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMN QTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNER ITSVDTPLGGDSEKALLDILADEKENGPEDTTQDDDMKQSIVKWLFELNAK" variation 75 /citation=[3] /replace="t" variation 97 /citation=[3] /replace="t" variation 99 /citation=[3] /replace="t" variation 808 /citation=[3] /replace="t" BASE COUNT 254 a 223 c 291 g 225 t ORIGIN 1 atgagtcaga atacgctgaa agttcatgat ttaaatgaag atgcggaatt tgatgagaac 61 ggagttgagg tttttgacga aaaggcctta gtagaatatg aacccagtga taacgatttg 121 gccgaagagg aactgttatc gcagggagcc acacagcgtg tgttggacgc gactcagctt 181 taccttggtg agattggtta ttcaccactg ttaacggccg aagaagaagt ttattttgcg 241 cgtcgcgcac tgcgtggaga tgtcgcctct cgccgccgga tgatcgagag taacttgcgt 301 ctggtggtaa aaattgcccg ccgttatggc aatcgtggtc tggcgttgct ggaccttatc 361 gaagagggca acctggggct gatccgcgcg gtagagaagt ttgacccgga acgtggtttc 421 cgcttctcaa catacgcaac ctggtggatt cgccagacga ttgaacgggc gattatgaac 481 caaacccgta ctattcgttt gccgattcac atcgtaaagg agctgaacgt ttacctgcga 541 accgcacgtg agttgtccca taagctggac catgaaccaa gtgcggaaga gatcgcagag 601 caactggata agccagttga tgacgtcagc cgtatgcttc gtcttaacga gcgcattacc 661 tcggtagaca ccccgctggg tggtgattcc gaaaaagcgt tgctggacat cctggccgat 721 gaaaaagaga acggtccgga agataccacg caagatgacg atatgaagca gagcatcgtc 781 aaatggctgt tcgagctgaa cgccaaatag cgtgaagtgc tggcacgtcg attcggtttg 841 ctggggtacg aagcggcaac actggaagat gtaggtcgtg aaattggcct cacccgtgaa 901 cgtgttcgcc agattcaggt tgaaggcctg cgccgtttgc gcgaaatcct gcaaacgcag 961 gggctgaata tcgaagcgct gttccgcgag taa // ------------------------------------------------------------------------------ 7.2. Part of the contents in the accession number index file 'ddbjacc1.idx' The following excerpt from the accession number index file illustrates the format of the index. ------------------------------------------------------------------------------ D00001 ECPBPA BCT X04516 D00002 ECPYRC BCT X04469 D00003 HUMP450M HUM D00003 D00004 FLBFLBL40 VRL D00004 D00005 IBAMEM682 VRL D00005 D00006 BACPNS1981 BCT D00006 D00007 CHKCALGRP VRT D00007 D00008 ECPNTAB BCT X04195 D00009 DROPER1 INV D00009 ------------------------------------------------------------------------------ 7.3. Part of the contents in the keyword phrase index file 'ddbjkey1.idx' Keyword phrases consist of names for gene products and other characteristics of sequence entries. ------------------------------------------------------------------------------ "COAT PROTEIN SMO511347 VRL AJ511347 'TNPA GENE UBA564903 BCT AJ564903 'ZINC-FINGER' MOTIF PRNS53 VRL X60546 (+) MATING TYPE SURFACE PROTEIN ABGPSSP PLN M94861 (1,3 TABETGLUB PLN Z22874 (1,3)-BETA-D-GLUCAN BINDING PROTEIN AJ606470 INV AJ606470 (1,3)BETA-GLUCAN SYNTHASE NCU09275 PLN U09275 (1,4)-BETA-D-ARABINOXYLAN ARABINOFURANOHYDROLASE ANAXHA PLN Z78011 ANTUAXHA PLN Z78010 (1,6)-BETA-GLUCAN BIOSYNTHESIS YSAKRE1A PLN M81588 (1-3)-BETA-GLUCANASE NTSP41AGN PLN X81560 PA13BGPT PLN X57794 (1-3,1-4)-BETA-D-GLUCANASE HVBDG PLN X52572 (1-4)-BETA-MANNAN ENDOHYDROLASE CAR278996 PLN AJ278996 CAR293305 PLN AJ293305 (2',5'-OLIGOISOADENYLATE SYNTHETASE-DEPENDENT) AL138776 HUM AL138776 (2'-5') OLIGO(A) SYNTHASE E16 SSO4G06 EST F14610 (2'-5')OLIGOADENYLATE SYNTHETASE HSA225089 HUM AJ225089 HUMSYN25A HUM D00068 SSA225090 MAM AJ225090 (6')-IB' AMINOGLYCOSIDE ACETYLTRANSFERASE AXY278514 BCT AJ278514 PAE291609 BCT AJ291609 (8,11)-LINOLEOYL DESATURASE COF245938 PLN AJ245938 ------------------------------------------------------------------------------ 7.4. Part of the contents in the journal citation index file 'ddbjjou1.idx' The journal citation index file lists all of the citations that appear in the references. ------------------------------------------------------------------------------ (ER) AAPS PHARMSCI. 4 (3), DOI 10.1208/PS040315 (2002) AY170916 ROD AY170916 (ER) AM. J. HUM. GENET. 76 (1) (2004) IN PRESS AY753209S1 HUM AY753209 AY753209S2 HUM AY753210 (ER) ARCH. VIROL. (2004) IN PRESS AF531505 VRL AF531505 AY518899 VRL AY518899 AY518900 VRL AY518900 AY518901 VRL AY518901 AY518902 VRL AY518902 AY518903 VRL AY518903 AY518904 VRL AY518904 AY518905 VRL AY518905 AY518906 VRL AY518906 AY518907 VRL AY518907 AY518908 VRL AY518908 AY518909 VRL AY518909 AY518910 VRL AY518910 AY518911 VRL AY518911 AY518912 VRL AY518912 AY518913 VRL AY518913 AY518914 VRL AY518914 AY518915 VRL AY518915 AY518916 VRL AY518916 AY518917 VRL AY518917 AY518918 VRL AY518918 AY518919 VRL AY518919 AY518920 VRL AY518920 AY518921 VRL AY518921 AY518922 VRL AY518922 AY518923 VRL AY518923 AY518924 VRL AY518924 AY518925 VRL AY518925 AY518926 VRL AY518926 AY518927 VRL AY518927 AY518928 VRL AY518928 AY518929 VRL AY518929 AY518930 VRL AY518930 AY518931 VRL AY518931 AY518932 VRL AY518932 AY521234 VRL AY521234 AY521235 VRL AY521235 AY521236 VRL AY521236 AY521237 VRL AY521237 AY521238 VRL AY521238 (ER) ARTERIOSCLER. THROMB. VASC. BIOL. (2004) IN PRESS AY563557 HUM AY563557 (ER) BIOCHEM. BIOPHYS. RES. COMMUN. 325 (1), 203-214 (2004) AY563137 HUM AY563137 (ER) BIOCHEM. J./10.1042/BJ20030293 HSA496460 HUM AJ496460 ------------------------------------------------------------------------------ 7.5. Part of the contents in the gene name index file 'ddbjgen.idx' This file lists all the gene names that appear in the feature table. ------------------------------------------------------------------------------ 'ARR BX927156 BCT BX927156 'BGLG BX927156 BCT BX927156 'BGLS BX927148 BCT BX927148 'BGLY' BX927156 BCT BX927156 'BRNQ AF305888 BCT AF305888 'COMK AL591983 BCT AL591983 AL596172 BCT AL596172 'CRCB BX927155 BCT BX927155 'CRTI BX927155 BCT BX927155 'DPPE LDDIPEP BCT Z34898 'FIC BX936398 BCT BX936398 ------------------------------------------------------------------------------ 8. Release history Release Date Entries Bases Comments 83 09/10 124,079,491 117,728,717,442 82 06/10 120,034,097 115,169,689,543 81 03/10 116,720,237 112,394,932,676 TPA excluded 80 12/09 112,314,250 109,636,862,252 SOURCE line modified 79 09/09 108,593,519 106,684,379,504 DBLINK line started PROJECT line terminated 78 06/09 105,737,359 104,597,360,291 77 03/09 102,099,156 101,765,388,414 76 12/08 98,220,409 98,741,908,446 75 09/08 92,840,037 95,219,505,205 TSA division started 74 06/08 87,903,140 91,294,770,939 73 03/08 83,167,582 86,099,950,395 KIPO inclusion started 72 12/07 79,004,098 82,592,245,487 Most of E-mail addresses discarded 71 09/07 76,273,345 79,706,204,461 70 06/07 72,801,679 76,788,510,646 69 03/07 67,523,680 71,775,679,500 PROJECT line started Indexes for categories terminated 68 12/06 64,267,978 68,259,314,742 1.5 GB storage started 67 09/06 61,144,621 65,443,024,193 66 06/06 58,176,628 62,945,843,881 65 03/06 55,890,995 60,564,721,635 TPA subcategories started 64 12/05 52,272,669 56,098,558,378 Some index files split 63 09/05 47,741,593 52,246,110,341 62 06/05 45,249,444 49,158,155,283 ENV division started Version for release note started 61 03/05 43,118,204 47,099,081,750 Changed style of release note 60 12/04 40,583,945 44,416,752,273 /db_xref="H-inv:**" started 59 09/04 37,926,117 42,245,956,937 58 06/04 34,917,581 39,812,635,108 57 03/04 32,693,678 38,008,449,840 56 12/03 30,405,173 36,079,046,032 55 09/03 27,753,140 34,280,225,489 54 06/03 25,149,821 32,162,041,177 53 02/03 23,250,813 29,711,299,332 52 12/02 20,354,812 26,931,456,316 51 09/02 18,401,358 22,782,404,136 TPA started 50 06/02 17,260,693 20,158,357,982 49 04/02 16,503,157 18,579,627,226 48 01/02 15,016,100 16,197,713,855 47 10/01 13,266,610 14,145,671,645 46 07/01 12,313,759 13,037,646,166 45 04/01 11,434,113 12,207,092,905 HTC division started 44 01/01 10,165,597 11,136,298,841 43 10/00 8,666,551 10,034,532,698 42 07/00 7,554,995 8,880,721,093 41 04/00 5,962,608 6,409,581,885 CON division started 40 01/00 5,388,125 4,762,696,173 RNA division terminated 39 10/99 4,810,773 3,728,000,562 NID and PID discarded 38 07/99 4,294,369 3,098,519,597 37 03/99 3,311,627 2,375,261,951 VERSION, /protein_id started 36 01/99 3,073,166 2,190,425,560 35 10/98 2,759,261 1,957,341,169 34 07/98 2,412,785 1,708,580,623 33 04/98 2,174,769 1,479,303,279 32 01/98 1,956,669 1,300,950,613 31 10/97 1,731,532 1,139,869,464 Adoption of the unified taxonomy database 30 07/97 1,534,115 992,788,339 NID and PID terminated 29 04/97 1,270,194 841,415,232 28 01/97 1,154,120 756,785,219 HTG division started ORG division terminated 27 10/96 936,697 608,103,057 GSS division started 26 07/96 835,552 551,932,448 25 04/96 744,490 499,300,364 /translation started 24 01/96 637,508 431,771,652 23 10/95 569,757 390,694,350 22 07/95 437,588 322,982,425 HUM division started 21 04/95 274,596 250,875,023 20 01/95 239,689 231,299,557 19 10/94 204,332 205,274,131 18 07/94 185,230 192,473,021 17 04/94 169,957 179,942,209 16 01/94 154,626 165,017,628 15 10/93 131,649 147,224,690 14 07/93 120,350 138,686,333 JPO inclusion started 13 04/93 112,067 129,784,445 12 01/93 97,683 120,815,244 EST division started 11 07/92 65,693 84,839,075 10 01/92 59,317 77,805,556 GenBank/EMBL inclusion started 9 07/91 1,130 2,002,124 8 01/91 879 1,573,442 7 07/90 681 1,154,211 6 01/90 496 841,236 5 07/89 395 679,378 4 01/89 302 535,985 3 07/88 230 345,850 2 01/88 142 199,392 1 07/87 66 108,970 Started with DDBJ only ------------------ Since release 81 ------------------ TPA category data have been excluded from DDBJ periodical release: Since September 2002 (DDBJ release 51), we provided DDBJ periodical releases including TPA category data. However, it is potentially confusing, because TPA category is not primary nucleotide sequence data. Therefore, DDBJ terminated to include TPA data. TPA data has been available from the other FTP site. See following site in detail. URL; http://www.ddbj.nig.ac.jp/whatsnew/whatsnew2009-e.html#090828 ------------------ Since release 80 ------------------ The format of the SOURCE line in DDBJ flat file has been changed: The SOURCE lines in some of DDBJ flat file included a common name like as GenBank flat file. The change is shown below ---------------- Old (-rel. 79) ---------------- Format: SOURCE [] Example: SOURCE Homo sapiens mitochondrion ---------------- New (rel. 80-) ---------------- Format: SOURCE [] [()] Example: SOURCE mitochondrion Homo sapiens (human) See also '2. DDBJ flat file format'. ------------------ Since release 79 ------------------ A new line, DBLINK, has replaced PROJECT line: Following the agreement at the INSD collaborative meeting in 2008, the scope of the project ID has expanded to include projects that are not necessarily targeted to the sequencing of a complete genome. In addition, there are other resources such as the Trace Assembly Archive at the NCBI and the like. Therefore, we have decided to replace the PROJECT line by a new line format, "DBLINK". The replacement is illustrated in the following; From the use of the PROJECT line (-release 78); ------------------------------------------------------------------------------- LOCUS AP000000 4700000 bp DNA circular BCT 27-FEB-2009 DEFINITION Escherichia coli DDBJ genomic DNA, complete genome. ACCESSION AP000000 VERSION AP000000.1 PROJECT GenomeProject:99999 KEYWORDS . ------------------------------------------------------------------------------- To the DBLINK line format (release 79-); ------------------------------------------------------------------------------- LOCUS AP000000 4700000 bp DNA circular BCT 27-FEB-2009 DEFINITION Escherichia coli DDBJ genomic DNA, complete genome. ACCESSION AP000000 VERSION AP000000.1 DBLINK Project:99999 KEYWORDS . ------------------------------------------------------------------------------- ------------------ Since release 75 ------------------ A new division for assembled mRNA sequences, Transcriptome Shotgun Assembly (TSA), has been included since the release 75. With new sequencing technologies in use, INSDC have faced many requests to accept assembled EST sequences. These sequence data have become more useful than used to be, although they may not be correctly assembled or exist in nature. Therefore, INSDC decided to collect assembled EST sequences and classified them into the new division 'TSA'. TSA sequences are shotgun assemblies of primary sequences deposited in the EST division of INSDC, race Archive (TA) or Short-Read Archive (SRA). Two specific keywords, "TSA" and "Transcriptome Shotgun Assembly", are present in all TSA entries. The new division code, "TSA", is also described in the the LOCUS line in all TSA entries. No format changes in the flat file are anticipated for the TSA division, however, note that TSA entries make use of the same PRIMARY line that is described for the entries in TPA category. The PRIMARY block contains references to the underlying reads/transcripts that are assembled to construct a TSA record. Note that it is required for a TSA submission to submit sequence data of primary transcripts to the EST division of INSDC, TA, or SRA. More information about how to submit a TSA entry is provided via the following URL; http://www.ddbj.nig.ac.jp/sub/tsa-e.html ------------------ Since release 73 ------------------ Introduction of the sequence data from the Korean Intellectual Property Office: The nucleotide sequence data transferred from Korean Intellectual Property Office (KIPO) have been included in DDBJ release. See also, '3. Division categories' and '3.1. Notice for patent related sequence data'. ------------------ Since release 72 ------------------ Deletion of E-mail address, phone and fax numbers from DDBJ flat file: To follow the Japanese law of protecting personal information, DDBJ deleted both phone and fax numbers, and E-mail address from the flat files of the entries submitted to DDBJ. It would be also helpful to protect DDBJ releases against SPAM mail senders. DDBJ retrofitted most of all entries submitted to DDBJ, not to GenBank or EMBL, by the DDBJ periodical release 72. Previously, the submitter information was described in JOURNAL line at REFERENCE 1 as, -------------------------------------------------------------------------------- REFERENCE 1 (bases 1 to 1200) AUTHORS Mishima,T. TITLE Direct Submission JOURNAL Submitted (01-Jan-1990) to the DDBJ/EMBL/GenBank databases. Taro Mishima, DNA Data Bank of Japan, National Institute of Genetics; 1111, Yata, Mishima, Shizuoka 411-8540, Japan (E-mail:ddbj@ddbj.nig.ac.jp, URL:http://www.ddbj.nig.ac.jp/, Tel:81-12-345-6789, Fax:81-12-345-9876) -------------------------------------------------------------------------------- After the deletion or the information in question, DDBJ flat file is either one of the following two types; Type 1: Phone and fax numbers and E-mail address are deleted. -------------------------------------------------------------------------------- REFERENCE 1 (bases 1 to 1200) AUTHORS Mishima,T. TITLE Direct Submission JOURNAL Submitted (01-Jan-1990) to the DDBJ/EMBL/GenBank databases. Contact:Taro Mishima DNA Data Bank of Japan, National Institute of Genetics; 1111, Yata, Mishima, Shizuoka 411-8540, Japan URL :http://www.ddbj.nig.ac.jp/ ------------------------------------------------------------------------------- Type 2: When the submitters wish to keep their contact information disclosed, it is described as, ------------------------------------------------------------------------------- REFERENCE 1 (bases 1 to 1200) AUTHORS Mishima,T. TITLE Direct Submission JOURNAL Submitted (01-Jan-1990) to the DDBJ/EMBL/GenBank databases. Contact:Taro Mishima DNA Data Bank of Japan, National Institute of Genetics; 1111, Yata, Mishima, Shizuoka 411-8540, Japan URL :http://www.ddbj.nig.ac.jp/ E-mail :ddbj@ddbj.nig.ac.jp Phone :81-12-345-6789 Fax :81-12-345-9876 ------------------------------------------------------------------------------- ------------------ Since release 69 ------------------ Introduction of the project ID at PROJECT line in DDBJ flat file: Following the agreement at the INSD collaborative meeting in 2006, INSDC has started to assign the project ID for submissions from sequencing projects. The description of project ID is shown as below; ---------------------------------------------------------------------------- A unique identifier, assigned at the time of the submission by a sequencing project that informed INSDC of the submission beforehand. It is recommended that the submitter quotes the assigned project ID in all communication with INSDC databases to allow for easier and faster tracking of issues. The project ID field provides an umbrella identifier that points to all related sequence data for the project. ---------------------------------------------------------------------------- The PROJECT lines contain INSDC-assigned ID for the sequencing project. It will be appeared between VERSION and KEYWORDS lines in DDBJ flat files, from the DDBJ periodical release, 69 as shown below. See also '2. DDBJ flat file format'. ---------------------------------------------------------------------------- ACCESSION AB012345 VERSION AB012345.1 PROJECT GenomeProject:123 KEYWORDS . ---------------------------------------------------------------------------- Termination of providing the index files for each category: ------------------ Since release 68 ------------------ Split of files: We changed the maximum file size from 300 MB to 1.5 GB, because the network capacity has been remarkably increased. Each file named as ddbj***##.seq has at most 1.5 GB storage capacity. See also the sections, '6. File categories' and '9. File list'. ------------------ Since release 64 ------------------ Split of index files: In the present release, some of index files (ddbjacc.idx, ddbjjou.idx, and ddbjkey.idx) have been greater than 2 GB in the file size. So, these have been recorded in multiple ddbj****.idx files, each of which at most has 1.5 GB storage capacity as follows, respectively. See also 6., 7.2., 7.3., 7.4. and 9. ------------------ Since release 62 ------------------ Release version number is introduced: DDBJ has started to include the item, 'version', for its release note, which indicates a version for its periodical release. It is expressed like '62.0', in which the digit(s) after the period is a version number. The reason for adding the version number is that a released data is sometimes revised due to urgent and necessary corrections. The number is increased by one every time when a revised periodical release is made public until the next release. Introduction of ENV division: Recently, the submissions of the sequences derived from environmental samples have rapidly increased. To accommodate such submissions, a new division, ENV, has been created (See also '3.1. Division categories'). This division contains the sequences obtained via direct molecular isolation such as PCR, DGGE, or any anonymous method. In the past, the sequences derived from environmental samples belonged to taxonomic divisions, mainly BCT. At DDBJ, the retrofit to transfer relevant entries from taxonomic divisions to the ENV division starts in the present release, and ends by the next periodical release. Please note that during this transitional period, some entries to be eventually placed in the ENV division will be found in other divisions. Strand information is removed: The strand information of LOCUS line in the flat file has been removed as shown below. See also '2.1. LOCUS line'. ---------------------------------------------------------------------------- Old (-rel. 61): 44-44 space 45-47 spaces, ss- (single-stranded), ds- (double-stranded), or ms- (mixed-stranded) New (rel. 62-): 44-47 spaces ---------------------------------------------------------------------------- ------------------ Since release 61 ------------------ The style of release note (this file) has been changed. Some entries have the sequential format for the secondary accession numbers in the ACCESSION line, in order to make the expression of secondary accession numbers in the past short. For example; ------------------------------------------------------------------------------ Before; ACCESSION AB000802 D85885 D85886 D85887 After; ACCESSION AB000802 D85885-D85887 ------------------------------------------------------------------------------ See also '2.3. ACCESSION line'. ------------------ Since release 60 ------------------ The cross-reference to the H-invitational has been included. ------------------ Since release 56 ------------------ The three data banks have agreed that the maximum length limitation (350 kb) of a submitted sequence be relaxed. The BASE COUNT line of the DDBJ flat file format has been changed, corresponding to the relaxation of the maximum sequence length restriction in the entry that had been practiced at DDBJ/EMBL/GenBank International Nucleotide Sequence Databases. In the BASE COUNT line of the DDBJ flat file, 6 digits had been allocated for each number of a, c, g, t and other bases in the sequence. Hereafter, in the new flat file format, 9 digits are allocated for each number of a, c, g and t, while the numbers of other bases are removed. In accordance with the relaxation of sequence length limitation, GenBank had already dropped the BASE COUNT line from their flat file format from GenBank Release 138 (Oct. 2003). We DDBJ have decided to maintain the BASE COUNT line in our flat file format from the view that GC contents are still important information to characterize the sequence. The changes in the BASE COUNT line are shown below. ---------------------------------------------------------------------------- Old (-rel. 55): 1 6 11 16 21 26 31 36 41 46 51 56 61 66 71 |----|----|----|----|----|----|----|----|----|----|----|----|----|----| BASE COUNT 123456 a 123456 c 123456 g 123456 t 123456 others New (rel. 56-): 1 6 11 16 21 26 31 36 41 46 51 56 61 66 71 |----|----|----|----|----|----|----|----|----|----|----|----|----|----| BASE COUNT 123456789 a 123456789 c 123456789 g 123456789 t ---------------------------------------------------------------------------- ------------------ Since release 54 ------------------ '/sequenced_mol' qualifier has been changed to '/mol_type' qualifier. We accordingly completed retrofitting the pertinent entries. This change was made on the agreement at the INSD collaborative meeting in 2002. ------------------ Since release 51 ------------------ The format of LOCUS line in the flat file has been changed as shown below to adjust to the GenBank format. ------------------------------------------------------------------------------ Old (-rel. 50): LOCUS AB000001 660 bp DNA PLN 01-FEB-2001 New (rel. 51-): LOCUS AB000001 660 bp DNA linear PLN 01-FEB-2001 ------------------------------------------------------------------------------ ------------------ Since release 45 ------------------ The HTC (High Throughput cDNA) division has been included. This is to include unfinished high throughput cDNA sequences, each of which has 5'UTR and 3'UTR at both ends and part of a coding region. The sequence may also include introns. When the sequence becomes finished later, it moves to the corresponding taxonomic division. The sequence is accompanied with a keyword, HTC (High Throughput cDNA), which is dropped when the sequence is finished and moved to a taxonomic division. ------------------ Since release 41 ------------------ The CON division has been included. This division is to show the order of related sequences in a genome, and expressed by join and the accession numbers of the sequences. The contents of the CON division are compiled by the three data banks not by the data submitter. ------------------ Since release 40 ------------------ The RNA division was terminated. ------------------ Since release 37 ------------------ The three data banks include the item VERSION in the flat file, which indicates a version of a submitted nucleotide sequence. It is expressed like AB123456.1, in which the digit(s) after the period is a version number. The reason for adding VERSION is that since a released sequence sometimes revised by the submitter, the accession number alone cannot specify the sequence in question causing the user a trouble. The number is increased by one every time when a revised sequence is made public. Accordingly, the translated protein sequence will be accompanied with a /protein_id which is expressed as BAA12345.1, in which the digit(s) after the period is again a version number. The number is increased by one when the corresponding nucleotide sequence is revised and the protein sequence is changed as a result, and when the revised protein sequence is made public. ------------------ Since release 31 ------------------ We have started adopting the unified taxonomy database to unify the biological source of the sequence. The database is made up with scientific names, ID of unidentified organisms, and synthetic constructs etc. ------------------ Since release 30 ------------------ NID and PID were terminated. This change was made on the agreement at the INSD collaborative meeting in 1999. ------------------ Since release 28 ------------------ The HTG (High Throughput Genomic sequence) has been included. We terminated the ORG (Organelle) division. ------------------ Since release 27 ------------------ The GSS division has been included. GSS stands for Genome Survey Sequence, which is similar to EST, except that GSS is genomic DNA whereas EST is cDNA. ------------------ Since release 25 ------------------ DDBJ release contains amino acid sequences that were translated from the corresponding nucleotide sequences of the database. ------------------ Since release 22 ------------------ The HUM division has been included. We have the human (HUM) division solely for human sequences and the primate (PRI) division for non-human primate sequences. ------------------ Since release 12 ------------------ The EST (Expressed Sequence Tag) division has been included. ------------------ Since release 10 ------------------ The sequences submitted to GenBank or EMBL have been included in the release. 9. File list The files in this release are arranged in the following order with non-labeled format. ----------------------------------------------------------------------- file name file size ----------------------------------------------------------------------- ddbjrel.txt (DDBJ release note) 74130 ddbjacc1.idx (Accession number index file 1) 1499999996 ddbjacc2.idx (Accession number index file 2) 1500000025 ddbjacc3.idx (Accession number index file 3) 1500000032 ddbjacc4.idx (Accession number index file 4) 341093203 ddbjgen.idx (Gene name index file) 193545499 ddbjjou1.idx (Journal citation index file 1) 1499999848 ddbjjou2.idx (Journal citation index file 2) 1499951989 ddbjjou3.idx (Journal citation index file 3) 1461025887 ddbjjou4.idx (Journal citation index file 4) 875169145 ddbjkey1.idx (Keyword phrase index file 1) 1499999946 ddbjkey2.idx (Keyword phrase index file 2) 1499999942 ddbjkey3.idx (Keyword phrase index file 3) 1499999988 ddbjkey4.idx (Keyword phrase index file 4) 359731568 ----------------------------------------------------------------------- file name number of entries number of bases file size ----------------------------------------------------------------------- ddbjbct1.seq 131712 609034883 1499001744 ddbjbct2.seq 94353 655676891 1507605341 ddbjbct3.seq 498 668027792 1500398951 ddbjbct4.seq 339 660884743 1499786865 ddbjbct5.seq 391 663731116 1499066535 ddbjbct6.seq 518 657612144 1500801742 ddbjbct7.seq 18157 637712872 1499003749 ddbjbct8.seq 242742 581150222 1503072588 ddbjbct9.seq 148582 214121870 614370501 ddbjenv1.seq 569231 410519931 1499001555 ddbjenv2.seq 564040 405529169 1499002483 ddbjenv3.seq 507805 443861762 1499000219 ddbjenv4.seq 717261 260345294 1499000197 ddbjenv5.seq 282781 255909883 810180116 ddbjest1.seq 461393 172634180 1499000344 ddbjest2.seq 488859 191341325 1499003543 ddbjest3.seq 496956 205469066 1499000947 ddbjest4.seq 478955 204204109 1498999951 ddbjest5.seq 546886 291070856 1499000581 ddbjest6.seq 551254 337275259 1498999926 ddbjest7.seq 538792 307452641 1498999987 ddbjest8.seq 403508 130467194 1499002814 ddbjest9.seq 487687 208919793 1499000108 ddbjest10.seq 510406 236203665 1499001573 ddbjest11.seq 469264 200648995 1499000449 ddbjest12.seq 372454 132627442 1499002751 ddbjest13.seq 274545 83820437 1499002284 ddbjest14.seq 274833 108397690 1499004513 ddbjest15.seq 381599 177584006 1499000954 ddbjest16.seq 480226 248115793 1499000005 ddbjest17.seq 463563 243381048 1499002495 ddbjest18.seq 451786 248459762 1499000798 ddbjest19.seq 464495 222893212 1499000194 ddbjest20.seq 463292 280641774 1499001021 ddbjest21.seq 468639 285893041 1499001762 ddbjest22.seq 467736 244163648 1499000578 ddbjest23.seq 446832 262938279 1499001325 ddbjest24.seq 506525 279243767 1499001085 ddbjest25.seq 547853 319273060 1499001990 ddbjest26.seq 413742 209471019 1499000353 ddbjest27.seq 434160 255369026 1499002455 ddbjest28.seq 479162 271760449 1499000672 ddbjest29.seq 515514 261747354 1499001435 ddbjest30.seq 451051 242069806 1499001079 ddbjest31.seq 457246 253930600 1499001479 ddbjest32.seq 441315 288737480 1499000759 ddbjest33.seq 408959 292464832 1499002640 ddbjest34.seq 500152 297793958 1499000766 ddbjest35.seq 637007 366711883 1499002181 ddbjest36.seq 470687 299808674 1499002089 ddbjest37.seq 416273 243454389 1499003894 ddbjest38.seq 258556 96981166 1499000348 ddbjest39.seq 259065 105120236 1499003057 ddbjest40.seq 316338 151795575 1499000098 ddbjest41.seq 473893 269428594 1499000968 ddbjest42.seq 480410 266496198 1499002849 ddbjest43.seq 445616 239171062 1499002537 ddbjest44.seq 476190 281299610 1499001810 ddbjest45.seq 514929 258400464 1499002460 ddbjest46.seq 432818 256507214 1499001449 ddbjest47.seq 555829 284855206 1499001849 ddbjest48.seq 428756 244713607 1499002909 ddbjest49.seq 401134 234965512 1499002621 ddbjest50.seq 262887 133932834 1499001453 ddbjest51.seq 267929 109300104 1499004070 ddbjest52.seq 309875 137102449 1499000196 ddbjest53.seq 416092 231520867 1499000139 ddbjest54.seq 558592 317593630 1499001649 ddbjest55.seq 425941 286104915 1499000262 ddbjest56.seq 442873 243922205 1499000499 ddbjest57.seq 475833 280802159 1499002172 ddbjest58.seq 430787 234680651 1499002137 ddbjest59.seq 478810 268287588 1499001270 ddbjest60.seq 449825 276322427 1499001079 ddbjest61.seq 419850 241422160 1499001539 ddbjest62.seq 492444 333279433 1499000026 ddbjest63.seq 447523 273903548 1499000276 ddbjest64.seq 447061 225382913 1499000996 ddbjest65.seq 436325 269485522 1499000694 ddbjest66.seq 432579 279037101 1499001789 ddbjest67.seq 394231 256649433 1499003432 ddbjest68.seq 430988 239073941 1499000513 ddbjest69.seq 424559 236212661 1499002789 ddbjest70.seq 428706 237742463 1499002739 ddbjest71.seq 426653 225613952 1499002528 ddbjest72.seq 509066 296647252 1499000738 ddbjest73.seq 540650 331969093 1499002768 ddbjest74.seq 572300 338951077 1499001290 ddbjest75.seq 452375 278683453 1499001607 ddbjest76.seq 440105 315724292 1499001144 ddbjest77.seq 440245 285663601 1499003341 ddbjest78.seq 482120 290447024 1499000711 ddbjest79.seq 381788 260531915 1499002371 ddbjest80.seq 387928 276051953 1499002066 ddbjest81.seq 395884 273787304 1499001749 ddbjest82.seq 405954 308246956 1499002104 ddbjest83.seq 482346 306605728 1499001626 ddbjest84.seq 439409 317959605 1499002027 ddbjest85.seq 524377 301395731 1499001676 ddbjest86.seq 594354 190068338 1499002432 ddbjest87.seq 493394 318873804 1499001389 ddbjest88.seq 494885 316397487 1499000263 ddbjest89.seq 515952 307628245 1499002987 ddbjest90.seq 657143 316516973 1499001802 ddbjest91.seq 570993 251516268 1499002814 ddbjest92.seq 507562 318973204 1499001055 ddbjest93.seq 503272 289972449 1499001217 ddbjest94.seq 555147 195490971 1499002779 ddbjest95.seq 511204 319404852 1499000250 ddbjest96.seq 425895 242473290 1499003403 ddbjest97.seq 586033 189135685 1499000871 ddbjest98.seq 525179 256512279 1499001794 ddbjest99.seq 565861 210702120 1499001901 ddbjest100.seq 483224 292151178 1499002902 ddbjest101.seq 497256 330072814 1499000082 ddbjest102.seq 508975 301164275 1499000588 ddbjest103.seq 581470 225523785 1499001164 ddbjest104.seq 551690 276099820 1499001198 ddbjest105.seq 432401 273834478 1499000134 ddbjest106.seq 459031 282949504 1499002164 ddbjest107.seq 451102 286131419 1499001659 ddbjest108.seq 464683 331115691 1499002507 ddbjest109.seq 461051 305842681 1499002249 ddbjest110.seq 405790 271235692 1499002520 ddbjest111.seq 455422 297370489 1499001217 ddbjest112.seq 432475 265642646 1499000897 ddbjest113.seq 429955 270475164 1499003280 ddbjest114.seq 471344 264000713 1499001900 ddbjest115.seq 374767 242429013 1499002379 ddbjest116.seq 505422 234831521 1499001039 ddbjest117.seq 471195 283095698 1499000587 ddbjest118.seq 399447 261143128 1499002571 ddbjest119.seq 497592 295965878 1499001079 ddbjest120.seq 322781 217181366 1499001914 ddbjest121.seq 415202 205602702 1499001992 ddbjest122.seq 476413 161383630 1499000183 ddbjest123.seq 661365 329005031 1499000701 ddbjest124.seq 409206 257525715 1499002992 ddbjest125.seq 563980 264373680 1499001849 ddbjest126.seq 513048 291500891 1499002126 ddbjest127.seq 525437 368808791 1499002891 ddbjest128.seq 545883 322382315 1499001119 ddbjest129.seq 522789 301359462 1499000513 ddbjest130.seq 463598 49686888 1499002355 ddbjest131.seq 449740 121840319 1499000093 ddbjest132.seq 484595 302079661 1499000280 ddbjest133.seq 426267 290390732 1499003186 ddbjest134.seq 445029 297138361 1499001823 ddbjest135.seq 487979 186233341 1499002529 ddbjest136.seq 464213 306008181 1499001762 ddbjest137.seq 473077 297084182 1499003264 ddbjest138.seq 405372 262845547 1499001199 ddbjest139.seq 478195 272125592 1498999964 ddbjest140.seq 419386 265333089 1499002118 ddbjest141.seq 310707 202071337 1499002952 ddbjest142.seq 393677 246628302 1498999978 ddbjest143.seq 473256 286620832 1499000428 ddbjest144.seq 479016 226271337 1499000294 ddbjest145.seq 309342 114179592 979028638 ddbjgss1.seq 478719 345667394 1499000931 ddbjgss2.seq 446189 342001624 1499001872 ddbjgss3.seq 441999 334125058 1499003596 ddbjgss4.seq 565829 273900383 1499001131 ddbjgss5.seq 489550 254257939 1499000864 ddbjgss6.seq 466703 256076676 1499002587 ddbjgss7.seq 392117 194492815 1499000324 ddbjgss8.seq 432058 214722292 1499002045 ddbjgss9.seq 489771 269856863 1499000022 ddbjgss10.seq 543726 301911791 1499000028 ddbjgss11.seq 512592 320088596 1499000663 ddbjgss12.seq 545095 352299088 1499000800 ddbjgss13.seq 500322 358498638 1499002352 ddbjgss14.seq 514899 356072147 1499001364 ddbjgss15.seq 604773 340156331 1499001754 ddbjgss16.seq 606261 368802606 1499002706 ddbjgss17.seq 563574 319934342 1499001378 ddbjgss18.seq 522718 373217355 1499003685 ddbjgss19.seq 511475 339200493 1499001366 ddbjgss20.seq 576380 368228538 1499003380 ddbjgss21.seq 579219 413335761 1499000457 ddbjgss22.seq 537321 322495339 1499000028 ddbjgss23.seq 481004 285357424 1499001737 ddbjgss24.seq 518411 339770305 1498999969 ddbjgss25.seq 529934 337813497 1499000563 ddbjgss26.seq 538196 352801447 1499001567 ddbjgss27.seq 591879 291420858 1499002031 ddbjgss28.seq 577099 288129365 1499000555 ddbjgss29.seq 554695 322555450 1499002939 ddbjgss30.seq 464398 383921435 1499001293 ddbjgss31.seq 475221 345964908 1499000169 ddbjgss32.seq 528128 372743256 1499001182 ddbjgss33.seq 597464 344565684 1499000792 ddbjgss34.seq 447909 333031991 1499002232 ddbjgss35.seq 525350 359088955 1499000205 ddbjgss36.seq 511616 243192081 1499000010 ddbjgss37.seq 574527 299784413 1499000675 ddbjgss38.seq 419946 307684503 1499002395 ddbjgss39.seq 409727 336711607 1499001803 ddbjgss40.seq 424009 347509192 1499002678 ddbjgss41.seq 414940 330666967 1499002572 ddbjgss42.seq 423518 345405379 1499000164 ddbjgss43.seq 421347 347685643 1499002131 ddbjgss44.seq 411866 331469943 1499002940 ddbjgss45.seq 519619 343705985 1499001517 ddbjgss46.seq 533607 339393301 1499001711 ddbjgss47.seq 596887 401324802 1499001587 ddbjgss48.seq 587724 413154591 1499000508 ddbjgss49.seq 477176 327881718 1499002386 ddbjgss50.seq 508383 303225228 1499002730 ddbjgss51.seq 533412 338792360 1499002101 ddbjgss52.seq 511967 410529048 1499002635 ddbjgss53.seq 564075 408003516 1499002257 ddbjgss54.seq 542647 338125881 1499001556 ddbjgss55.seq 537951 352220685 1499000756 ddbjgss56.seq 324001 244973562 957769260 ddbjhtc1.seq 278740 362861686 1499000086 ddbjhtc2.seq 287015 296494160 1056521701 ddbjhtg1.seq 11401 1118134308 1499042134 ddbjhtg2.seq 7563 1118325499 1499159604 ddbjhtg3.seq 5914 1130520782 1499051915 ddbjhtg4.seq 5462 1140237292 1499125046 ddbjhtg5.seq 5349 1144070989 1499265497 ddbjhtg6.seq 5355 1144136360 1499158219 ddbjhtg7.seq 6595 1132384046 1499176057 ddbjhtg8.seq 6855 1143131965 1499183805 ddbjhtg9.seq 6260 1139332911 1499076590 ddbjhtg10.seq 6338 1133108426 1499015893 ddbjhtg11.seq 7034 1123268246 1499178570 ddbjhtg12.seq 7004 1125508716 1499024584 ddbjhtg13.seq 6942 1141394681 1499098843 ddbjhtg14.seq 6974 1134989717 1499017673 ddbjhtg15.seq 6759 1141191753 1499060552 ddbjhtg16.seq 6303 1138751578 1499157204 ddbjhtg17.seq 6647 1139615355 1499042046 ddbjhtg18.seq 8048 1145364289 1499079895 ddbjhtg19.seq 6440 1127522688 1499104046 ddbjhtg20.seq 6605 1159020612 1499085666 ddbjhtg21.seq 6526 1159286532 1499016271 ddbjhtg22.seq 2291 411930122 533526107 ddbjhum1.seq 31366 1044430283 1499145964 ddbjhum2.seq 8099 1069281281 1499027143 ddbjhum3.seq 146213 824850853 1499058787 ddbjhum4.seq 22101 1073236775 1499075587 ddbjhum5.seq 236927 581062641 1499000999 ddbjhum6.seq 74248 123812325 319960685 ddbjinv1.seq 242225 692024680 1499696951 ddbjinv2.seq 425444 455190926 1499001532 ddbjinv3.seq 271070 625745302 1499001257 ddbjinv4.seq 264315 267712340 1029690844 ddbjmam.seq 242471 680599517 1398986208 ddbjpat1.seq 1053905 509565505 1499259280 ddbjpat2.seq 753907 502502884 1499000437 ddbjpat3.seq 719560 345478766 1499000900 ddbjpat4.seq 714076 585981510 1499053854 ddbjpat5.seq 718267 403311236 1498999960 ddbjpat6.seq 732183 311887204 1499001173 ddbjpat7.seq 675788 370001584 1499001721 ddbjpat8.seq 711484 526152081 1499000132 ddbjpat9.seq 925471 532077416 1499000682 ddbjpat10.seq 630931 476643363 1499000673 ddbjpat11.seq 666183 350286664 1499000816 ddbjpat12.seq 505745 615345074 1502067196 ddbjpat13.seq 668029 319907633 1499000802 ddbjpat14.seq 868046 566975127 1499000468 ddbjpat15.seq 1069647 344885997 1499012389 ddbjpat16.seq 895371 569849358 1499002126 ddbjpat17.seq 1394073 331017750 1499000490 ddbjpat18.seq 1283417 212269264 1499002091 ddbjpat19.seq 698694 500184213 1499000995 ddbjpat20.seq 1125381 161501820 1370657282 ddbjphg.seq 5566 43849529 107728190 ddbjpln1.seq 104370 946105077 1498999965 ddbjpln2.seq 261462 536139523 1499057655 ddbjpln3.seq 75820 904116432 1499070505 ddbjpln4.seq 316591 578959235 1499002084 ddbjpln5.seq 423569 476719458 1499001059 ddbjpln6.seq 472459 437621797 1499001860 ddbjpln7.seq 141868 165119827 515552424 ddbjpri1.seq 46557 1082768950 1499001390 ddbjpri2.seq 36400 144131505 261542750 ddbjrod1.seq 36266 1016181721 1499018525 ddbjrod2.seq 5893 1092561500 1499233625 ddbjrod3.seq 35910 1062543944 1499000836 ddbjrod4.seq 83310 878143545 1499074301 ddbjrod5.seq 246496 253326658 756044843 ddbjsts1.seq 415990 209745188 1499002851 ddbjsts2.seq 338052 238158605 1499001861 ddbjsts3.seq 565275 186242477 1499000311 ddbjsts4.seq 442 116879 878427 ddbjsyn.seq 92257 142378503 499213545 ddbjtsa1.seq 680430 288040413 1499001526 ddbjtsa2.seq 237577 112435220 495403934 ddbjuna.seq 290 3607874 6920605 ddbjvrl1.seq 385881 407838142 1499000620 ddbjvrl2.seq 367541 419461430 1499000608 ddbjvrl3.seq 129339 150733095 527630234 ddbjvrt1.seq 243110 688367963 1499008034 ddbjvrt2.seq 66392 992923348 1499002415 ddbjvrt3.seq 279403 698711519 1499001329 ddbjvrt4.seq 138816 158634055 500381852 ----------------------------------------------------------------------- Total 124079491 117728717442 432486057533 ddbjcon1.seq 106229 0 1499003730 ddbjcon2.seq 101523 0 1500391707 ddbjcon3.seq 285648 0 1499004629 ddbjcon4.seq 451674 0 1499001448 ddbjcon5.seq 300306 0 1499001494 ddbjcon6.seq 267466 0 1499003530 ddbjcon7.seq 268376 0 1499000979 ddbjcon8.seq 268296 0 1499003767 ddbjcon9.seq 280423 0 1499002295 ddbjcon10.seq 321650 0 1499001256 ddbjcon11.seq 308360 0 1499003113 ddbjcon12.seq 278927 0 1499001174 ddbjcon13.seq 288768 0 1499001391 ddbjcon14.seq 290279 0 1499002311 ddbjcon15.seq 247518 0 1499005714 ddbjcon16.seq 241772 0 1499004624 ddbjcon17.seq 556751 0 1499000510 ddbjcon18.seq 469967 0 1499000131 ddbjcon19.seq 387329 0 1499854635 ddbjcon20.seq 325364 0 1499001393 ddbjcon21.seq 87204 0 1105994920 The entries and bases in the CON division are not counted in the numbers given on the top of the release note or 'Total' on the above table.